KEGG   Homo sapiens (human): 6532Help
Entry
6532              CDS       T01001                                 

Gene name
SLC6A4, 5-HTT, 5-HTTLPR, 5HTT, HTT, OCD1, SERT, SERT1, hSERT
Definition
(RefSeq) solute carrier family 6 member 4
  KO
K05037  solute carrier family 6 (neurotransmitter transporter, serotonin) member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
Disease
H01450  Obsessive-compulsive disorder
Drug target
Alaproclate: D02787
Amitifadine (DG01386): D10088 D10089
Amitriptyline (DG00934): D00809 D07448
Amitriptylinoxide: D07449
Amoxapine: D00228
Centanafadine (DG01858): D10697 D10698
Cidoxepin hydrochloride: D03491
Citalopram (DG00943): D00822 D07704 D07705
Clomipramine (DG00929): D00811 D07727
Cocaine (DG00808): D00110 D02182
Dapoxetine: D03649
Desipramine (DG00927): D00812 D07791
Desvenlafaxine (DG00963): D02570 D07793
Dexfenfluramine (DG00105): D03713 D07805
Dexmethylphenidate (DG00972): D03721 D07806
Dosulepin (DG00940): D01546 D07872
Doxepin (DG00937): D00814 D07875
Duloxetine (DG00962): D01179 D07880
Escitalopram (DG00947): D02567 D07913
Fenfluramine (DG00103): D04148 D07945
Fluoxetine (DG00942): D00326 D00823
Fluvoxamine (DG00946): D00824 D07984
Imipramine (DG00928): D00815 D08070 D08071
Imipraminoxide (DG01542): D07334 D08072
Indeloxazine (DG02869): D02170 D08077
Levomilnacipran (DG01387): D10072 D10133
Liafensine: D10443
Lofepramine (DG00932): D01285 D08140
Lubazodone hydrochloride: D04788
Mazindol: D00367
Metamfetamine (DG00968): D02242 D08187
Milnacipran (DG00960): D01107 D08222
Nortriptyline (DG00935): D00816 D08288
Paroxetine (DG00944): D02260 D02362 D05374 D05375
Phentermine (DG00102): D05458 D05459
Pirandamine hydrochloride: D05491
Protriptyline (DG00936): D00484 D08447
Sertraline (DG00945): D00825 D02360
Sibutramine (DG00108): D02571 D08513
Trazodone (DG00952): D00820 D08626
Trimipramine (DG00931): D00394 D02408
Venlafaxine (DG00959): D00821 D08670
Vilazodone (DG00964): D09698 D09699
Vortioxetine (DG00965): D10184 D10185
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    6532 (SLC6A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6532 (SLC6A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6532 (SLC6A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF 5HT_transport_N
Motif
Other DBs
NCBI-GeneID: 6532
NCBI-ProteinID: NP_001036
OMIM: 182138
HGNC: 11050
Ensembl: ENSG00000108576
Vega: OTTHUMG00000132751
Pharos: P31645(Tclin)
UniProt: P31645 B2R7Y7
Structure
PDB: 

Position
17q11.2
AA seq 630 aa AA seqDB search
METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
PGTFKERIIKSITPETPTEIPCGDIRLNAV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggagacgacgcccttgaattctcagaagcagctatcagcgtgtgaagatggagaagat
tgtcaggaaaacggagttctacagaaggttgttcccaccccaggggacaaagtggagtcc
gggcaaatatccaatgggtactcagcagttccaagtcctggtgcgggagatgacacacgg
cactctatcccagcgaccaccaccaccctagtggctgagcttcatcaaggggaacgggag
acctggggcaagaaggtggatttccttctctcagtgattggctatgctgtggacctgggc
aatgtctggcgcttcccctacatatgttaccagaatggagggggggcattcctcctcccc
tacaccatcatggccatttttgggggaatcccgctcttttacatggagctcgcactggga
cagtaccaccgaaatggatgcatttcaatatggaggaaaatctgcccgattttcaaaggg
attggttatgccatctgcatcattgccttttacattgcttcctactacaacaccatcatg
gcctgggcgctatactacctcatctcctccttcacggaccagctgccctggaccagctgc
aagaactcctggaacactggcaactgcaccaattacttctccgaggacaacatcacctgg
accctccattccacgtcccctgctgaagaattttacacgcgccacgtcctgcagatccac
cggtctaaggggctccaggacctggggggcatcagctggcagctggccctctgcatcatg
ctgatcttcactgttatctacttcagcatctggaaaggcgtcaagacctctggcaaggtg
gtgtgggtgacagccaccttcccttatatcatcctttctgtcctgctggtgaggggtgcc
accctccctggagcctggaggggtgttctcttctacttgaaacccaattggcagaaactc
ctggagacaggggtgtggatagatgcagccgctcagatcttcttctctcttggtccgggc
tttggggtcctgctggcttttgctagctacaacaagttcaacaacaactgctaccaagat
gccctggtgaccagcgtggtgaactgcatgacgagcttcgtttcgggatttgtcatcttc
acagtgctcggttacatggctgagatgaggaatgaagatgtgtctgaggtggccaaagac
gcaggtcccagcctcctcttcatcacgtatgcagaagcgatagccaacatgccagcgtcc
actttctttgccatcatcttctttctgatgttaatcacgctgggcttggacagcacgttt
gcaggcttggagggggtgatcacggctgtgctggatgagttcccacacgtctgggccaag
cgccgggagcggttcgtgctcgccgtggtcatcacctgcttctttggatccctggtcacc
ctgacttttggaggggcctacgtggtgaagctgctggaggagtatgccacggggcccgca
gtgctcactgtcgcgctgatcgaagcagtcgctgtgtcttggttctatggcatcactcag
ttctgcagggacgtgaaggaaatgctcggcttcagcccggggtggttctggaggatctgc
tgggtggccatcagccctctgtttctcctgttcatcatttgcagttttctgatgagcccg
ccacaactacgacttttccaatataattatccttactggagtatcatcttgggttactgc
ataggaacctcatctttcatttgcatccccacatatatagcttatcggttgatcatcact
ccagggacatttaaagagcgtattattaaaagtattaccccagaaacaccaacagaaatt
ccttgtggggacatccgcttgaatgctgtgtaa

DBGET integrated database retrieval system