KEGG   Homo sapiens (human): 6533Help
Entry
6533              CDS       T01001                                 

Gene name
SLC6A6, TAUT
Definition
(RefSeq) solute carrier family 6 member 6
  KO
K05039  solute carrier family 6 (neurotransmitter transporter, taurine) member 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6533 (SLC6A6)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6533 (SLC6A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 6533
NCBI-ProteinID: NP_003034
OMIM: 186854
HGNC: 11052
Ensembl: ENSG00000131389
Vega: OTTHUMG00000155525
Pharos: P31641(Tbio)
UniProt: P31641 B4E140 Q59GD7
Position
3p25.1
AA seq 620 aa AA seqDB search
MATKEKLQCLKDFHKDILKPSPGKSPGTRPEDEAEGKPPQREKWSSKIDFVLSVAGGFVG
LGNVWRFPYLCYKNGGGAFLIPYFIFLFGSGLPVFFLEIIIGQYTSEGGITCWEKICPLF
SGIGYASVVIVSLLNVYYIVILAWATYYLFQSFQKELPWAHCNHSWNTPHCMEDTMRKNK
SVWITISSTNFTSPVIEFWERNVLSLSPGIDHPGSLKWDLALCLLLVWLVCFFCIWKGVR
STGKVVYFTATFPFAMLLVLLVRGLTLPGAGAGIKFYLYPDITRLEDPQVWIDAGTQIFF
SYAICLGAMTSLGSYNKYKYNSYRDCMLLGCLNSGTSFVSGFAIFSILGFMAQEQGVDIA
DVAESGPGLAFIAYPKAVTMMPLPTFWSILFFIMLLLLGLDSQFVEVEGQITSLVDLYPS
FLRKGYRREIFIAFVCSISYLLGLTMVTEGGMYVFQLFDYYAASGVCLLWVAFFECFVIA
WIYGGDNLYDGIEDMIGYRPGPWMKYSWAVITPVLCVGCFIFSLVKYVPLTYNKTYVYPN
WAIGLGWSLALSSMLCVPLVIVIRLCQTEGPFLVRVKYLLTPREPNRWAVEREGATPYNS
RTVMNGALVKPTHIIVETMM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaaggagaagctgcagtgtctgaaagatttccacaaggacatcctgaagccc
tcaccagggaagagcccaggcacgcggcctgaggacgaggctgagggaaaacctccgcag
agggagaagtggtctagcaagatcgactttgtgctctctgtggctggcggcttcgtgggc
ttgggcaacgtctggcgcttcccgtacctctgctacaagaatggtggaggtgcgtttctc
ataccgtattttattttcctgtttgggagcggcctgcctgtgtttttcttggagatcatc
ataggccagtacacctctgaagggggcatcacctgctgggaaaagatctgccccttgttc
tctggtatcggctatgcctccgttgtaattgtgtccctcctgaatgtctactacatcgtc
atcctggcctgggccacatactacctgttccagtccttccagaaggagctgccctgggca
cactgcaaccacagctggaacacacctcactgcatggaggacaccatgcgcaagaacaag
agtgtctggatcaccatcagctccaccaacttcacctcccctgtcatcgagttctgggag
cgcaacgtgctgagcttgtcccctggaatcgaccacccaggctctctgaaatgggacctc
gctctctgccttcttttagtctggctagtgtgtttcttctgcatctggaagggcgtcagg
tccactgggaaggtcgtctacttcacagccacttttccattcgccatgctcctggtgctg
ctggtccgagggctgacgctgccgggcgcgggcgcaggcatcaagttctatctgtatcct
gacatcacccgccttgaggacccacaggtgtggattgacgctgggactcagatattcttc
tcttatgccatctgcctgggggctatgacctcgctggggagctacaacaagtacaagtat
aactcgtacagggactgtatgctgctgggatgcctgaacagtggtaccagttttgtgtct
ggcttcgcaattttttccatcctgggcttcatggcacaagagcaaggggtggacattgct
gatgtggctgagtcaggtcctggcctggccttcattgcctacccaaaagctgtgacaatg
atgccgctgcccacattttggtccattcttttttttattatgcttctcttgcttggactg
gatagccagtttgttgaagttgaaggacagatcacatccttggttgatctttacccatcc
ttcctaaggaagggttatcgtcgggaaatcttcatcgccttcgtgtgtagcatcagctac
ctgctggggctgacgatggtgacggagggtggcatgtatgtgtttcagctctttgactac
tatgcagctagcggtgtatgccttttgtgggttgcattctttgaatgttttgttattgcc
tggatatatggaggtgataacctttatgatggtattgaggacatgattggctatcggccc
gggccctggatgaagtacagctgggctgtgatcactccagttctctgtgttggatgtttc
atcttctcgctcgtcaagtacgtacccctgacctacaacaaaacatacgtgtaccccaac
tgggccattgggctgggctggagcctggccctttcctccatgctctgcgttcccttggtc
atcgtcatccgcctctgccagactgaggggccgttccttgtgagagtcaagtacctgctg
accccaagggaacccaaccgctgggctgtggagcgcgagggagccacaccttacaactct
cgcaccgtcatgaacggcgctctcgtgaaaccgacccacatcattgtggagaccatgatg
tga

DBGET integrated database retrieval system