KEGG   Homo sapiens (human): 653319Help
Entry
653319            CDS       T01001                                 

Gene name
KIAA0895L
Definition
(RefSeq) KIAA0895 like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1704
Motif
Other DBs
NCBI-GeneID: 653319
NCBI-ProteinID: NP_001035805
HGNC: 34408
Ensembl: ENSG00000196123
Vega: OTTHUMG00000172891
Pharos: Q68EN5(Tdark)
UniProt: Q68EN5
Position
16q22.1
AA seq 471 aa AA seqDB search
MVLDSGAQAYDQAPPSPPTSPPSLRHRLKPSDRDGPPLYPWSQSLALPLALAVPPALQPQ
PEQQPFSQMLLGHRGHMRRSESTYSVNSTGRRGRGTLGRPPPGRGRNPGGGTLRPAASLP
HIAKTQRDAGHIASKSPCMLVALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLEKY
CEASGQFIHQAVGIIEAVLEKFGTYEHFEAATGGQLLTKCQIWSIVRKYMQKEGCAGEVV
VQLSEDLLSQAVMMVENSRPTLAINLTGARQYWLEGMLRHEIGTHYLRGVNNARQPWHNA
EGRLRYGLRPANPTEEGLASLHSVLFRKQPFLWRAALLYYTIHRAARMSFRQLFQDLERY
VQDADVRWEYCVRAKRGQTDTSLPGCFSKDQVYLDGIVRILRHRQTIDFPLLTSLGKVSY
EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggactcaggggctcaggcgtatgatcaggcaccccccagcccgcctaccagt
cccccatccctgcgccataggctgaagccctcagaccgagatgggccaccactgtacccc
tggtctcagtccctggccttgcccctggctctggcagtccccccagcgctgcagccccag
cctgagcagcagccgttctcacagatgctcctgggccaccgtggccacatgcgtcgcagt
gagagcacctactctgtaaatagtactggccggcgggggcgtggcaccctgggacggcct
ccacctggacggggacggaacccaggtgggggcaccctgcggcctgcagcctccctgcct
cacattgctaagactcaaagggatgcaggccatattgccagcaagagcccctgcatgttg
gtggccctgcggccaaccaacatggaccgtgagcgagacaagttcttccagtcccattac
acctacaatccacagtttgagtaccaggagcccatgcccacggctgtgctggaaaagtac
tgcgaggcctctggacagttcatccatcaggcagttggcatcattgaggctgttctggag
aagtttggaacctatgaacactttgaggctgccactggggggcagctgctcaccaagtgc
cagatatggtcgattgtgcgcaaatacatgcagaaggagggctgcgctggggaggttgtg
gtgcagctgagtgaggacctgctgtcccaggcagtgatgatggtggagaacagccggccc
acattggcgatcaacctgaccggagcccgccagtactggttggagggcatgctgcggcat
gagataggcacccactacctgcggggcgtgaacaacgcgcgccagccgtggcacaacgcg
gagggccggctgcggtacgggctgcggccggcgaaccccacggaggagggcctggccagc
ctgcacagcgtgctgttccgcaagcagccgttcctgtggcgcgctgcactgctctactac
accatccaccgcgccgcgcgcatgtccttccgtcagctcttccaggacctggagcgctac
gtgcaggacgccgatgtgcgctgggagtactgcgtgcgcgccaagcgcggccagaccgac
acctcgctgccaggttgtttcagcaaggaccaggtgtacctggacggcatcgtgcgcatt
ctgcgacatcgccagaccatcgatttcccgttgctgacctcactgggcaaggtgtcctat
gaggatgtggaccacctgcggccccatggggtgctggataatacccgggtgccccacttc
atgcaggacttggcacgctaccggcagcagctggagcacatcatggccaccaaccggctg
gatgaggcggagctgggtcgcctgctacccgactga

DBGET integrated database retrieval system