KEGG   Homo sapiens (human): 653333
Entry
653333            CDS       T01001                                 

Gene name
FAM86B2
Definition
(RefSeq) family with sequence similarity 86 member B2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: FAM86 Methyltransf_16 Methyltransf_25 MTS Methyltransf_12 Importin_rep_5
Other DBs
NCBI-GeneID: 653333
NCBI-ProteinID: NP_001131082
OMIM: 616123
HGNC: 32222
Ensembl: ENSG00000145002
Vega: OTTHUMG00000165462
Pharos: P0C5J1(Tdark)
UniProt: P0C5J1
Position
8p23.1
AA seq 330 aa
MAPEENAGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVC
VKHPPSVKYAWCFLSELIKKHEAVHTEPLDKLYEVLAETLMAKESTQGHRSYLLSSGGSV
TLSKSTAIISHGTTGLVTWDAALYLAEWAIENPAAFINRTVLELGSGAGLTGLAICKMCR
PRAYIFSDPHSRILEQLRGNVLLNGLSLEADITGNLDSPRVTVAQLDWDVAMVHQLSAFQ
PDVVIAADVLYCPEAIVSLVGVLQRLAACREHKRAPEVYVAFTVRNPETCQLFTTELGRD
GIRWEAEAHHDQKLFPYGEHLEMAMLNLTL
NT seq 993 nt   +upstreamnt  +downstreamnt
atggcgcccgaggagaacgcggggaccgaactcttgctgcagggttttgagcgccgcttc
ctggcggtgcgcacactgcgctccttcccctggcagagcttagaggcaaagttaagagac
tcatcagattctgagctgctgcgggatattttgcagaagactgtgaggcatcctgtgtgt
gtgaagcacccgccgtcagtcaagtatgcctggtgctttctctcagaactcatcaaaaag
cacgaggctgtccacacggagcctttggacaaactgtacgaggtgctcgcggagactctg
atggccaaggagtccacccagggccaccggagctatttgctgtcctcaggaggctcagtc
acactctccaagagcacagccatcatctcccacggtaccacaggcctggtcacatgggat
gccgccctctaccttgcagaatgggccatcgagaacccggcagccttcattaacaggact
gtcctagagcttggcagtggtgccggcctcacaggccttgccatctgcaagatgtgccgc
ccccgggcatacatcttcagcgaccctcacagccggatcctcgagcagctccgagggaat
gtccttctcaatggcctctcattagaggcagacatcactggcaacttagacagccccagg
gtgacagtggcccagctggactgggacgtagcaatggtccatcagctctctgccttccag
ccagatgttgtcattgcagcagacgtgctgtattgcccagaagccatcgtgtcgctggtc
ggggtcctgcagaggctggctgcctgccgggagcacaagcgggctcctgaggtctacgtg
gcctttaccgtccgcaacccagagacatgccagctgttcaccaccgagctaggccgggat
gggatcagatgggaagcggaagctcatcatgaccagaaactgtttccctatggagagcac
ttggagatggcaatgctgaacctcacactgtag

DBGET integrated database retrieval system