KEGG   Homo sapiens (human): 6534
Entry
6534              CDS       T01001                                 

Symbol
SLC6A7, PROT
Name
(RefSeq) solute carrier family 6 member 7
  KO
K05040  solute carrier family 6 (neurotransmitter transporter, L-proline) member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    6534 (SLC6A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6534 (SLC6A7)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6534 (SLC6A7)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 6534
NCBI-ProteinID: NP_055043
OMIM: 606205
HGNC: 11054
Ensembl: ENSG00000011083
Vega: OTTHUMG00000130046
Pharos: Q99884(Tchem)
UniProt: Q99884
Position
5q32
AA seq 636 aa
MKKLQGAHLRKPVTPDLLMTPSDQGDVDLDVDFAAHRGNWTGKLDFLLSCIGYCVGLGNV
WRFPYRAYTNGGGAFLVPYFLMLAICGIPLFFLELSLGQFSSLGPLAVWKISPLFKGAGA
AMLLIVGLVAIYYNMIIAYVLFYLFASLTSDLPWEHCGNWWNTELCLEHRVSKDGNGALP
LNLTCTVSPSEEYWSRYVLHIQGSQGIGSPGEIRWNLCLCLLLAWVIVFLCILKGVKSSG
KVVYFTATFPYLILLMLLVRGVTLPGAWKGIQFYLTPQFHHLLSSKVWIEAALQIFYSLG
VGFGGLLTFASYNTFHQNIYRDTFIVTLGNAITSILAGFAIFSVLGYMSQELGVPVDQVA
KAGPGLAFVVYPQAMTMLPLSPFWSFLFFFMLLTLGLDSQFAFLETIVTAVTDEFPYYLR
PKKAVFSGLICVAMYLMGLILTTDGGMYWLVLLDDYSASFGLMVVVITTCLAVTRVYGIQ
RFCRDIHMMLGFKPGLYFRACWLFLSPATLLALMVYSIVKYQPSEYGSYRFPPWAELLGI
LMGLLSCLMIPAGMLVAVLREEGSLWERLQQASRPAMDWGPSLEENRTGMYVATLAGSQS
PKPLMVHMRKYGGITSFENTAIEVDREIAEEEESMM
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaagaagctccagggagctcacctccgcaagcctgtcaccccagacctgctgatgacc
cccagtgaccagggcgatgtcgacctggatgtggactttgctgcacaccgggggaactgg
acaggcaagctggacttcctgctgtcctgcattggctactgtgtaggcctggggaatgtc
tggcgcttcccctatcgagcgtacaccaatggaggaggcgccttcctcgtgccctacttc
ctcatgctggccatctgtggcatccccctcttcttcctggagctctccctgggccagttc
tccagcctagggcccctggctgtctggaaaatcagccctctcttcaaaggcgccggcgca
gccatgctgctcatcgtgggcttggtggccatctactacaacatgatcatcgcctacgtg
ctcttctacctcttcgcctccctcaccagcgacctaccctgggagcactgtggcaactgg
tggaacacagaactctgcctggagcacagagtctccaaggacggcaacggggccctgccc
ctcaacctcacctgcaccgtcagccccagcgaggagtactggagccgctacgtcctccac
atccaaggcagccagggcatcggcagccctggggagatccgctggaacctctgcctctgc
ctgctgctggcctgggtcatcgtgttcctctgtatcctcaagggtgtgaagtcttcgggc
aaggtggtgtatttcacggccacgttcccctacctcatcctgctcatgctgctggtccgc
ggagtcaccctcccaggggcctggaagggcatccagttctatctcaccccccagttccac
cacttgttgtcttccaaggtgtggattgaagctgctcttcagatcttctattccctgggt
gtgggcttcggggggctcctcacctttgcctcctacaacacgtttcaccagaacatctat
agagacactttcatcgtcactctgggcaacgccatcaccagcatcctggctggctttgcc
atcttctccgtgctgggctacatgtctcaggagctgggcgtgcctgtggaccaagtagcc
aaagcaggccctggcctggcctttgtcgtctacccacaggccatgaccatgctgcctctg
tcacccttctggtcctttctcttcttcttcatgcttctgactctcggcctagatagccag
tttgcttttctggagaccattgtgacagctgtgacagatgagttcccatactacctgcgg
cccaagaaggcggtgttctcagggctcatctgcgtggccatgtacctgatggggctgatc
ctcaccactgatgggggcatgtactggctggtccttctggatgactacagcgccagcttc
gggctgatggtggtggttatcaccacgtgccttgccgtgacacgggtgtatggcattcag
aggttctgccgagacatccacatgatgctgggcttcaagccgggcctctacttcagggcc
tgctggctgttcctgtccccagccacgctcttggccctcatggtgtatagcatcgtcaag
taccagccctcggagtatggcagttaccgcttcccgccctgggctgagctgctgggcatc
ctgatgggcctgctgtcctgcctcatgatcccagctggcatgctggtggctgtgcttcga
gaagagggctcactctgggagcggctccaacaggccagccggccggccatggactgggga
ccatcgctggaggagaaccggacgggcatgtatgtggccacgctggctgggagccagtca
ccaaagccactgatggtgcacatgcgcaagtacgggggcatcaccagcttcgagaacacg
gccatcgaggtggaccgtgagattgcagaggaggaggagtcgatgatgtga

DBGET integrated database retrieval system