KEGG   Homo sapiens (human): 653437Help
Entry
653437            CDS       T01001                                 

Gene name
AQP12B, INSSA3
Definition
(RefSeq) aquaporin 12B
  KO
K09871  aquaporin-12
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    653437 (AQP12B)
Transporters [BR:hsa02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    653437 (AQP12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 653437
NCBI-ProteinID: NP_001095937
HGNC: 6096
Ensembl: ENSG00000185176
Vega: OTTHUMG00000152263
Pharos: A6NM10(Tdark)
UniProt: A6NM10 Q8IUS6
Position
2q37.3
AA seq 307 aa AA seqDB search
MAGLNVSLSFFFATFTLCEAARRASKALLPVGAYEVFAREAVGAVQLGACFLEMRTLVEL
GPWAGDFGPDLLLTLLFLLFLAHGVTLDGASANPTVSLQEFLMAEESLPGTLLKLAAQGL
GMQAACTLTRLCWAWELSDLHLLQSLMAQSCSSALRTSVPHGALVEAACAFCFHLTLLHL
RHSPPAYSGPAVALLVTVTAYTAGPFTSAFFNPALAASVTFACSGHTLLEYVQVYWLGPL
TGMVLAVLLHQGRLPHLFQRNLFYGQKNKYRAPRGKPAPASGDTQTPAKGSSVREPGRSG
VEGPHSS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtcttaacgtgtccctctccttcttctttgccaccttcaccctctgtgaggca
gccaggcgggcctccaaggccctgctcccagtgggcgcctatgaagtcttcgcccgggag
gcggtgggcgcggtgcagctcggggcctgcttcctggagatgaggacgctggtcgagctc
gggccctgggctggggactttgggcctgacctgctgctcaccctgctcttcctgctcttc
ctggcgcacggggtcaccttggacggggcctcggccaaccccaccgtgtccctgcaggag
ttcctcatggccgaggagtctctgcctggcacgctgctgaagctggcggcacaggggctg
ggcatgcaggccgcctgcaccctgacgcgcctctgctgggcctgggagctcagtgacctg
cacctgctgcagagcctcatggcccagagctgcagctcggccctgcgcacatccgtgccc
cacggggcgcttgtggaggccgcctgcgccttttgtttccatctgaccctcctgcacctg
cggcacagtcctcccgcctacagcgggcccgctgtggctctgttggtcaccgtcacggcc
tacacggccgggcccttcacgtctgccttcttcaaccctgccctggccgcctctgtgacc
tttgcctgctcgggacacaccttactggagtacgtgcaggtgtactggctgggccctctg
acagggatggtcctggctgtgctgctgcaccagggccgccttccccaccttttccagagg
aacctgttctacggccagaagaacaagtaccgagcaccccgagggaagccggccccggcc
tcaggggacacccagacccctgcaaaggggtccagtgtccgggagcctgggcgcagtggt
gttgaggggccacattccagctga

DBGET integrated database retrieval system