KEGG   Homo sapiens (human): 653619Help
Entry
653619            CDS       T01001                                 

Gene name
PRAMEF15
Definition
(RefSeq) PRAME family member 15
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 653619
NCBI-ProteinID: NP_001091846
HGNC: 26764
Ensembl: ENSG00000204501
Vega: OTTHUMG00000008035
Pharos: Q5VWM5(Tdark)
UniProt: Q5VWM5
Position
1p36.21
AA seq 478 aa AA seqDB search
MKMSIRTPPRLLELAGRSLLRDQALAMSTLEELPTELFPPLFMEAFSRRRCEALKLMVQA
WPFRRLPLRPLIKMPCLEAFQAVLDGLDALLTQGVRPRRWKLQVLDLQDVCENFWMVWSE
AMAHGCFLNAKRNKKPVQDCPRMRGRQPLTVFVELWLKNRTLDEYLTYLLLWVKQRKDLL
HLCCKKLKILGMPFRNIRSILKMVNLDCIQEVEVNCKWVLPILTQFTPYLGHMRNLQKLV
LSHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLLSCLKTSLKV
LTITNCVLLESDLKHLSQCPSISQLKTLDLSGIRLTNYSLVPLQILLEKVAATLEYLDLD
DCGIIDSQVNAILPALSRCFELNTFSFCGNPICMATLENLLSHTIILKNLCVELYPAPRE
SYGADGTLCWSRFAQIRAELMNRVRDLRHPKRILFCTDYCPDCGNRSFYDLEADQYCC
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgagcatccggactccacccagactcctggagcttgcagggcggagcctgctg
agggaccaagctttggccatgtccaccctggaggagctgcccacagaacttttcccccca
ctgttcatggaggccttcagcaggagacgctgtgaggccctgaagctgatggtgcaggcc
tggcccttccgccgcctccctctgaggcctctgataaagatgccttgtctggaggccttc
caagctgtgctcgatgggcttgatgcactgcttacccaaggggttcgtcccaggaggtgg
aaactccaagtgctggatttacaggatgtctgtgagaacttctggatggtttggtctgaa
gctatggcccatgggtgcttcctcaatgccaagaggaacaaaaaaccagtgcaggactgt
ccaaggatgagaggacggcagcccttgactgtgttcgtagaactttggctcaagaacagg
actctggatgaatacctcacctacctccttctatgggtcaagcagaggaaagatttacta
cacctgtgctgtaagaagctgaaaattttgggaatgcccttccgcaatatcagaagcatc
ctgaaaatggtgaacctagactgtatccaggaggtggaagtgaattgcaagtgggtactg
cccatcctgacacagtttaccccatacctgggccacatgaggaatcttcagaagctcgtt
ctctcccacatggatgtctctcgctacgtttccccagagcagaagaaggagattgttacc
cagttcaccactcagttcctcaagctgcgctgcctccaaaagctttatatgaactctgtt
tctttcctcgaaggccacctggaccagctgctcagctgtctgaagacctcgttaaaagtc
ctcacaataactaactgtgtgcttttggaatcagacttgaagcatctatcccagtgcccg
agtatcagtcaactaaagaccctggacctgagtggcatcagactgaccaattatagtctt
gtgcctctccaaattctcctagaaaaagttgcagccacccttgagtacctggatttagat
gactgtggcatcatagactcccaagtcaacgccatcctgcctgccctgagccgctgcttt
gagctcaacaccttcagcttctgtggaaatcccatctgcatggccaccctggagaacctg
ctgagccacacaatcatactcaaaaacttatgtgtggagctgtatcctgccccccgagag
agttatggtgctgatggtactctctgctggagcagatttgctcaaattagggctgagctg
atgaacagagtgagggacttaaggcaccccaagaggatcttgttctgtactgactactgc
cctgactgtggcaacaggtcattttatgacctggaggcagatcaatactgctgttga

DBGET integrated database retrieval system