KEGG   Homo sapiens (human): 653643Help
Entry
653643            CDS       T01001                                 

Gene name
GOLGA6D
Definition
(RefSeq) golgin A6 family member D
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GOLGA2L5
Motif
Other DBs
NCBI-GeneID: 653643
NCBI-ProteinID: NP_001138696
HGNC: 32204
Ensembl: ENSG00000140478
Vega: OTTHUMG00000172672
Pharos: P0CG33(Tdark)
UniProt: P0CG33
Position
15q24.2
AA seq 693 aa AA seqDB search
MWPQPYLPPHPMMLEESRQNKLAAAKKKLKEYQQRKSPGIPAGAKTKKKKTDSSPETTTS
GGGHSPGDSQYQELAVALESSSVTINQLNENIESLKQQKKQVEHQLEEAKKTNNEIHKAQ
MEQLETINILTLEKADLKTTLYHTKRAARHFEEESKDLAGRLQYSLQHIQELERALCAVS
TQQQEEDRSSSCREAVLQRRLQQTIKERALLNAHVTQVTESLKQVQLERDEYAKHIKGER
ARWQERMWKMSVEARTLKEEKKRDIHRIQELERSLSELKNQMAEPPSLAPPAVTSVVEQL
QDEAKHLRQEVEGLEGKLQSQVENNQALSLLSKEQKQRLQEQEEMLREQEAQRVREQERL
CEQNERLREQQKTLQEQGERLRKQEQRLRKQEERLRKEEERLQKQEKRLWDQEERLWKKE
ERLQKQEERLALSQNHKLDKQLAEPQCSFEDLNNEKKSALQLEQQVKELQEKLDEEHLEA
ASQRNQQLETQLSLVALPGEGDGGQHLDSEEEEAPRPTPNIPEDLESREATSSFMDLPKE
KADGTEQVERRELGFVQPSGVTDGMRESFTVYESQGAVPNTRHQEMEDVIRLAQKEEEMK
VKLLELQELVLPLVGNHEGHGKFLIAAQNPADEPTPGAPAPQELGAAGEQDVFYEVSLDN
NVEPAPGVAREGSPHNNPTVQQIVQLSPVMQDT
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgtggccccaaccctacctccctccccaccccatgatgttagaagaatctcgacagaat
aaattggcagcagccaagaaaaagctaaaagaatatcagcaaaggaagagccctggtatt
ccagcaggagcaaagacaaaaaagaaaaaaactgacagtagccctgagacaaccacttcc
ggtggtggccactcacctggggatagccagtaccaagaactagcagtagccctggagtca
agctcagtgacaatcaatcagctcaatgaaaacatagaatcattgaaacagcagaagaaa
caagtggaacatcagctggaagaagcaaagaaaacaaacaatgaaatacacaaagcacaa
atggagcagttagagacaatcaacatcctcacattggaaaaggcagacttgaagaccacc
ctttaccatactaaacgtgctgcccgacacttcgaagaagagtccaaggatctggctggc
cgcctgcaatactccttacagcatattcaagaattggagcgggctctctgtgctgtgtct
acacagcagcaggaagaggacaggtcctcgagctgcagagaagcggtcctccagcggcgg
ttacagcagaccataaaggagcgggcgctgctgaacgcacacgtgacacaggtgacagag
tcactaaaacaagtccagctagagcgagacgaatatgctaaacacataaaaggagagagg
gcccggtggcaggagaggatgtggaaaatgtcggtggaggctcgaacattgaaggaagag
aagaagcgtgacatacatcggatacaggagctggagaggagcttgtccgaactcaaaaac
cagatggctgagcccccatccctggcacccccagcagtgacctctgtggtggaacagcta
caagatgaggccaaacacctgaggcaggaggtggaaggtctggagggaaagctccagtcc
caggtggaaaacaatcaggccttgagtctccttagcaaggaacaaaagcagagactccag
gagcaggaggagatgctccgagagcaggaggcgcagagagtgcgggagcaggagagactg
tgtgaacaaaacgagaggcttcgggagcagcagaagacgctacaggagcagggtgagagg
ctgcgaaagcaggagcagaggctacgcaaacaggaggagaggctgcgaaaggaggaggag
aggctgcaaaagcaggaaaagaggctgtgggaccaggaggagaggctgtggaagaaggag
gagaggctacaaaagcaggaggagaggctcgcgctctcccagaaccacaagctcgacaag
cagctggccgagccacagtgcagcttcgaggatctgaacaacgagaaaaagagcgcactg
cagttggagcagcaagtaaaggagctgcaggagaagctagacgaggagcacctagaagct
gccagccagcggaaccaacagctagagacccagctaagcctcgtggctctccctggagaa
ggagatggaggacaacatctggacagtgaggaggaggaggcgcctcggcccacgccaaac
atcccagaggacctggagagccgggaggccacgagcagctttatggacctcccgaaggag
aaggcggacgggacggagcaggtggagagacgagagcttggattcgtccagccttctgga
gtgacagacggcatgagagagtccttcaccgtatatgaaagccagggggcagtgccaaac
acgcggcaccaggagatggaggatgtcatcaggctggcccagaaggaggaggagatgaag
gtgaagctgctggagctgcaagagttggtgttgccccttgtgggcaaccatgaggggcat
ggcaaattcctcatcgctgcccagaaccctgctgatgagcccactccaggggccccagcc
ccccaggaacttggggctgccggtgagcaggatgttttttatgaagtgagcctggacaac
aacgtggagcctgcaccaggagtggccagggagggttctccccataacaaccccactgta
cagcagatcgtgcagctgtctcctgtcatgcaggacacctag

DBGET integrated database retrieval system