KEGG   Homo sapiens (human): 6539Help
Entry
6539              CDS       T01001                                 

Gene name
SLC6A12, BGT-1, BGT1, GAT2
Definition
(RefSeq) solute carrier family 6 member 12
  KO
K05045  solute carrier family 6 (neurotransmitter transporter, betaine/GABA) member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    6539 (SLC6A12)
   04721 Synaptic vesicle cycle
    6539 (SLC6A12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6539 (SLC6A12)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   6539 (SLC6A12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 6539
NCBI-ProteinID: NP_001116319
OMIM: 603080
HGNC: 11045
Ensembl: ENSG00000111181
Vega: OTTHUMG00000090309
Pharos: P48065(Tchem)
UniProt: P48065
Position
12p13.33
AA seq 614 aa AA seqDB search
MDGKVAVQECGPPAVSWVPEEGEKLDQEDEDQVKDRGQWTNKMEFVLSVAGEIIGLGNVW
RFPYLCYKNGGGAFFIPYFIFFFVCGIPVFFLEVALGQYTSQGSVTAWRKICPLFQGIGL
ASVVIESYLNVYYIIILAWALFYLFSSFTSELPWTTCNNFWNTEHCTDFLNHSGAGTVTP
FENFTSPVMEFWERRVLGITSGIHDLGSLRWELALCLLLAWVICYFCIWKGVKSTGKVVY
FTATFPYLMLVILLIRGVTLPGAYQGIIYYLKPDLFRLKDPQVWMDAGTQIFFSFAICQG
CLTALGSYNKYHNNCYKDCIALCFLNSATSFVAGFVVFSILGFMSQEQGVPISEVAESGP
GLAFIAFPKAVTMMPLSQLWSCLFFIMLIFLGLDSQFVCVECLVTASIDMFPRQLRKSGR
RELLILTIAVMCYLIGLFLVTEGGMYIFQLFDYYASSGICLLFLSLFEVVCISWVYGADR
FYDNIEDMIGYRPWPLVKISWLFLTPGLCLATFLFSLSKYTPLKYNNVYVYPPWGYSIGW
FLALSSMVCVPLFVVITLLKTRGPFRKRLRQLITPDSSLPQPKQHPCLDGSAGRNFGPSP
TREGLIAGEKETHL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggacgggaaggtggcagtgcaagagtgtgggcctcctgcagtctcctgggtccccgag
gagggagagaagttggaccaggaagacgaggaccaggtgaaggatcggggccaatggacc
aacaagatggagtttgtgctgtcagtggccggggagatcattgggctgggcaatgtctgg
aggtttccctatctctgctacaaaaacggaggtggagccttcttcatcccctacttcatc
ttcttctttgtctgcggcatcccggtgttcttcctggaggtggcgttgggccaatacacc
agccaagggagtgtcacagcctggaggaagatctgccccctcttccagggcattggtctg
gcatctgtggtcatcgagtcatatttgaatgtctactacatcatcatccttgcctgggct
ctcttctacctgttcagctccttcacttctgagctgccctggacgacctgcaacaacttt
tggaacacagagcattgcacggactttctgaaccactcaggagccggcacagtgacccca
tttgagaattttacctcacctgtcatggaattctgggagagacgagttctgggcatcacc
tcgggcatccatgacctgggctccctgcgctgggagctggccctgtgcctcctgctcgcc
tgggtcatctgctatttctgcatctggaagggggtcaagtccacaggcaaggtggtttat
ttcacagccacgtttccgtacctgatgcttgtcattttgctgatcagaggtgtcaccctt
cccggagcctaccagggcatcatctactacttgaagccagatttgttccgcctcaaggac
cctcaggtgtggatggatgcgggcacccagatcttcttctcctttgccatctgccagggg
tgcctgacagccctgggcagctacaacaagtatcacaacaactgctacaaggactgcatc
gccctctgcttcctgaacagtgccaccagctttgtggctgggtttgttgtcttctccatc
ctgggcttcatgtcccaagagcaaggggtgcccatttctgaagtggccgagtcaggtcct
gggctggccttcatcgccttccccaaggctgtgactatgatgcccttatcccagctgtgg
tcctgcctgttctttatcatgctcatattcctagggctggacagccagtttgtctgtgtg
gagtgcctggtgacagcctccatagacatgttccccaggcagctccggaagagcgggcgg
cgcgagctcctcatcctcaccatcgccgtcatgtgctacctgatagggcttttcctggtc
accgagggcgggatgtacatcttccagctgtttgactactatgcttccagtggcatatgc
ctgctgttcctgtcattgtttgaagtggtctgcataagctgggtgtatggggcggaccgt
ttctatgacaacattgaggacatgattggctaccggccatggcccctggtgaagatctcc
tggctcttcctgacccctggactttgcctggccactttcctcttctccttgagcaagtac
acccccctcaagtacaacaacgtctatgtgtacccgccctggggatactccattggctgg
ttcctggctctgtcctccatggtctgtgtcccactcttcgtcgtcatcaccctcctgaag
actcggggtcctttcaggaagcgtctgcgtcagctcatcacccctgactccagtctgcca
cagcccaagcaacatccctgcttggatggcagtgctggccggaactttgggccctcccca
acaagggaaggactgatagccggggagaaggagacccatttgtag

DBGET integrated database retrieval system