KEGG   Homo sapiens (human): 654Help
Entry
654               CDS       T01001                                 

Gene name
BMP6, VGR, VGR1
Definition
(RefSeq) bone morphogenetic protein 6
  KO
K16620  bone morphogenetic protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04913  Ovarian steroidogenesis
Module
hsa_M00679  BMP signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    654 (BMP6)
   04390 Hippo signaling pathway
    654 (BMP6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    654 (BMP6)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    654 (BMP6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    654 (BMP6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   654 (BMP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 654
NCBI-ProteinID: NP_001709
OMIM: 112266
HGNC: 1073
Ensembl: ENSG00000153162
Vega: OTTHUMG00000014217
Pharos: P22004(Tbio)
UniProt: P22004 Q4VBA3 B4DUF7
Structure
PDB: 

Position
6p24.3
AA seq 513 aa AA seqDB search
MPGLGRRAQWLCWWWGLLCSCCGPPPLRPPLPAAAAAAAGGQLLGDGGSPGRTEQPPPSP
QSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRPLHGLQQPQPPALRQQEEQQQQQQLP
RGEPPPGRLKSAPLFMLDLYNALSADNDEDGASEGERQQSWPHEAASSSQRRQPPPGAAH
PLNRKSLLAPGSGSGGASPLTSAQDSAFLNDADMVMSFVNLVEYDKEFSPRQRHHKEFKF
NLSQIPEGEVVTAAEFRIYKDCVMGSFKNQTFLISIYQVLQEHQHRDSDLFLLDTRVVWA
SEEGWLEFDITATSNLWVVTPQHNMGLQLSVVTRDGVHVHPRAAGLVGRDGPYDKQPFMV
AFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVS
FQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAP
TKLNAISVLYFDDNSNVILKKYRNMVVRACGCH
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgccggggctggggcggagggcgcagtggctgtgctggtggtgggggctgctgtgcagc
tgctgcgggcccccgccgctgcggccgcccttgcccgctgccgcggccgccgccgccggg
gggcagctgctgggggacggcgggagccccggccgcacggagcagccgccgccgtcgccg
cagtcctcctcgggcttcctgtaccggcggctcaagacgcaggagaagcgggagatgcag
aaggagatcttgtcggtgctggggctcccgcaccggccccggcccctgcacggcctccaa
cagccgcagcccccggcgctccggcagcaggaggagcagcagcagcagcagcagctgcct
cgcggagagccccctcccgggcgactgaagtccgcgcccctcttcatgctggatctgtac
aacgccctgtccgccgacaacgacgaggacggggcgtcggagggggagaggcagcagtcc
tggccccacgaagcagccagctcgtcccagcgtcggcagccgcccccgggcgccgcgcac
ccgctcaaccgcaagagccttctggcccccggatctggcagcggcggcgcgtccccactg
accagcgcgcaggacagcgccttcctcaacgacgcggacatggtcatgagctttgtgaac
ctggtggagtacgacaaggagttctcccctcgtcagcgacaccacaaagagttcaagttc
aacttatcccagattcctgagggtgaggtggtgacggctgcagaattccgcatctacaag
gactgtgttatggggagttttaaaaaccaaacttttcttatcagcatttatcaagtctta
caggagcatcagcacagagactctgacctgtttttgttggacacccgtgtagtatgggcc
tcagaagaaggctggctggaatttgacatcacggccactagcaatctgtgggttgtgact
ccacagcataacatggggcttcagctgagcgtggtgacaagggatggagtccacgtccac
ccccgagccgcaggcctggtgggcagagacggcccttacgacaagcagcccttcatggtg
gctttcttcaaagtgagtgaggtgcacgtgcgcaccaccaggtcagcctccagccggcgc
cgacaacagagtcgtaatcgctctacccagtcccaggacgtggcgcgggtctccagtgct
tcagattacaacagcagtgaattgaaaacagcctgcaggaagcatgagctgtatgtgagt
ttccaagacctgggatggcaggactggatcattgcacccaagggctatgctgccaattac
tgtgatggagaatgctccttcccactcaacgcacacatgaatgcaaccaaccacgcgatt
gtgcagaccttggttcaccttatgaaccccgagtatgtccccaaaccgtgctgtgcgcca
actaagctaaatgccatctcggttctttactttgatgacaactccaatgtcattctgaaa
aaatacaggaatatggttgtaagagcttgtggatgccactaa

DBGET integrated database retrieval system