KEGG   Homo sapiens (human): 6542
Entry
6542              CDS       T01001                                 
Symbol
SLC7A2, ATRC2, CAT2, HCAT2
Name
(RefSeq) solute carrier family 7 member 2
  KO
K13864  solute carrier family 7 (cationic amino acid transporter), member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6542 (SLC7A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   6542 (SLC7A2)
SSDB
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Other DBs
NCBI-GeneID: 6542
NCBI-ProteinID: NP_001008539
OMIM: 601872
HGNC: 11060
Ensembl: ENSG00000003989
Pharos: P52569(Tbio)
UniProt: P52569
Position
8:17494069..17570566
AA seq 658 aa
MIPCRAALTFARCLIRRKIVTLDSLEDTKLCRCLSTMDLIALGVGSTLGAGVYVLAGEVA
KADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTYVTVGELWAFITGWNLI
LSYVIGTSSVARAWSGTFDELLSKQIGQFLRTYFRMNYTGLAEYPDFFAVCLILLLAGLL
SFGVKESAWVNKVFTAVNILVLLFVMVAGFVKGNVANWKISEEFLKNISASAREPPSENG
TSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEVRNPQKAIPIGIVTSLLVCF
MAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVGWGPAKYVVAAGSLCALSTSLLGSIFPM
PRVIYAMAEDGLLFKCLAQINSKTKTPIIATLSSGAVAALMAFLFDLKALVDMMSIGTLM
AYSLVAACVLILRYQPGLSYDQPKCSPEKDGLGSSPRVTSKSESQVTMLQRQGFSMRTLF
CPSLLPTQQSASLVSFLVGFLAFLVLGLSVLTTYGVHAITRLEAWSLALLALFLVLFVAI
VLTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMVQLSADTWVRFSIWMAIGFLIYFS
YGIRHSLEGHLRDENNEEDAYPDNVHAAAEEKSAIQANDHHPRNLSSPFIFHEKTSEF
NT seq 1977 nt   +upstreamnt  +downstreamnt
atgattccttgcagagccgcgctgacctttgcccgatgtctgatccggagaaaaatcgtg
accctggacagtctagaagacaccaaattatgccgctgcttatccaccatggacctcatt
gccctgggcgttggaagcacccttggggccggggtttatgtcctcgctggggaggtggcc
aaggcagactcgggccccagcatcgtggtgtccttcctcattgctgccctggcttcagtg
atggctggcctctgctatgccgaatttggggcccgtgttcccaagacggggtctgcatat
ttgtacacctacgtgactgtcggagagctgtgggccttcatcactggctggaatctcatt
ttatcgtatgtgataggtacatcaagtgttgcaagagcctggagtggcacctttgatgaa
cttcttagcaaacagattggtcagtttttgaggacatacttcagaatgaattacactggt
cttgcagaatatcccgatttttttgctgtgtgccttatattacttctagcaggtcttttg
tcttttggagtaaaagagtctgcttgggtgaataaagtcttcacagctgttaatattctc
gtccttctgtttgtgatggttgctgggtttgtgaaaggaaatgtggcaaactggaagatt
agtgaagagtttctcaaaaatatatcagcaagtgccagagagccaccttctgaaaacgga
acaagtatctatggggctggtggctttatgccttatggctttacgggaacgttggctggt
gctgcaacttgcttttatgcctttgtgggatttgactgcattgcaacaactggtgaagaa
gttcggaatccccagaaagctattcccattggaattgtgacgtctttgcttgtttgcttt
atggcctattttggggtctctgcagctttaacacttatgatgccgtactacctcctcgat
gaaaaaagcccccttcctgtagcgtttgaatatgtgggatggggtcctgccaaatatgtc
gtcgcagctggttctctctgcgccttgtcaacaagtcttcttggatccattttcccaatg
cctcgtgtaatctatgctatggcggaggatgggttgcttttcaaatgtctagctcaaatc
aattccaaaacgaagacaccaataattgctactttatcatcgggtgcagtggcagctttg
atggcctttctgtttgacctgaaggcgcttgtggacatgatgtccattggcacactcatg
gcctactctctggtggcagcctgtgttctcatcctcaggtaccagcctggcttatcttac
gaccagcccaaatgttctcctgagaaagatggtctgggatcgtctcccagggtaacctcg
aagagtgagtcccaggtcaccatgctgcagagacagggcttcagcatgcggaccctcttc
tgcccctcccttctgccaacacagcagtcagcttctctcgtgagctttctggtaggattc
ctagctttcctcgtgttgggcctgagtgtcttgaccacttacggagttcatgccatcacc
aggctggaggcctggagcctcgctctcctcgcgctgtttcttgttctcttcgttgccatc
gttctcaccatctggaggcagccccagaatcagcaaaaagtagccttcatggttccattc
ttaccatttttgccagcgttcagcatcttggtgaacatttacttgatggtccagttaagt
gcagacacttgggtcagattcagcatttggatggcaattggcttcctgatttacttttct
tatggcattagacacagcctggagggtcatctgagagatgaaaacaatgaagaagatgct
tatccagacaacgttcatgcagcagcagaagaaaaatctgccattcaagcaaatgaccat
cacccaagaaatctcagttcacctttcatattccatgaaaagacaagtgaattctaa

DBGET integrated database retrieval system