KEGG   Homo sapiens (human): 654254
Entry
654254            CDS       T01001                                 

Gene name
ZNF732
Definition
(RefSeq) zinc finger protein 732
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB XPA_N zf-C2H2_6 zf-C2H2_11 zf_UBZ zf-RING_7 Zn-ribbon_8 zf-C2H2_jaz zf-trcl zf-C2H2_8 zinc_ribbon_15 GAGA
Other DBs
NCBI-GeneID: 654254
NCBI-ProteinID: NP_001131080
HGNC: 37138
Ensembl: ENSG00000186777
Vega: OTTHUMG00000159883
Pharos: B4DXR9(Tdark)
UniProt: B4DXR9
Position
4p16.3
AA seq 585 aa
MELLTFRDVAIEFSPEEWKCLDPAQQNLYRDVMLENYRNLISLGVAISNPDLVIYLEQRK
EPYKVKIHETVAKHPAVCSHFTQDFLPVQGIEDSFHKLILRRYEKCGHENLELRKSCKRK
VQKGGYNEFNQCLSTIQSKIFQCNVHVKVFSTFSNSNQRRIRHTGEKHFKECGKSFQKFS
DLTQHQGIHAGEKPYTCEECGKDFKWYLIFNEYEIIHTGEKPFTCEECGNIFTTSSNFAK
HKVHTGEKSYKYEECGKAFNRSSTLTKHKRIHAEEKPFTCEECGKIITSSSNVAKHKKIH
TGEKLYKCQECGKVFNRSTTLTKHNRIHTGEKPYTCEECGKAFSRSSVLNEHKRIHTGEK
PYKCEQCGKAFRQSATLNKHKSIHTGEKPYTCEECGKAFSRFTTLNEHKRIHTGERPHKC
EECGKAFGWSTDLNKHKIIHTGEKPYKCEECGKAFGWSAYLSKHKKIHTGEKPYRCEECG
KAFLCSRALNKHKTIHTGEKPYECEECGKAFGWSTYLSKHKKIHTGEKPYRCEECGKAFR
RSRVLNKYKTIHTGDKTPKCKGCGKAFKWSSYLNQHNKIYTGEKL
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggaactcttaacattcagggatgtggccatagaattctctccagaagagtggaaatgc
ctggaccctgcccagcagaatttgtatagagatgtgatgttggagaactacaggaacctg
atctccctgggtgttgctatctctaacccagacctggtcatctatctggagcaaagaaag
gagccctacaaagtgaagatacatgagacagtagccaaacacccagctgtgtgttctcat
ttcacccaagactttttgccagtgcaggggatagaagattcgttccacaaacttatatta
agaagatatgagaaatgtggacatgagaatttagaattaagaaaaagctgtaaaaggaag
gtgcagaaaggaggttataatgaatttaatcaatgcttgtcaactatccagagcaaaata
tttcagtgtaatgtacatgtcaaagtatttagtacattttcaaattcaaaccaacgtagg
ataagacatactggagagaaacactttaaagaatgtggcaagtcatttcagaagttctca
gacctaactcaacatcaaggaattcatgctggagagaaaccctacacatgtgaagaatgt
ggcaaagactttaaatggtatttaatctttaatgaatatgagataattcatactggagag
aaacccttcacatgtgaagaatgtggcaacatctttaccacatcctcaaactttgctaaa
cataaagttcatactggagagaaatcttacaaatatgaagaatgtggcaaagcctttaat
aggtcctcaacccttactaagcataagagaattcatgctgaagagaaacccttcacatgt
gaagaatgtggcaaaatcattacctcatcctcaaatgttgccaaacataagaaaattcat
accggagagaaactctacaaatgtcaggaatgtggcaaagtctttaataggtccacaacc
cttactaaacataacagaattcatactggagagaaaccctacacatgtgaagaatgtggc
aaagcctttagtaggtcctcagttctgaatgaacataagagaattcatactggagagaag
ccctacaaatgtgaacaatgtggcaaagcctttagacaatccgcaacccttaataaacat
aagagtattcatactggagagaaaccctacacatgtgaagaatgtggaaaagcctttagt
cggttcacaacccttaatgaacataagagaattcatactggagagaggccccacaaatgt
gaagagtgtggcaaagcctttggatggtccacagacctgaataaacataagataattcat
actggagagaaaccttacaaatgtgaagagtgtggcaaagcctttggatggtctgcatac
ctgagtaaacataagaaaattcatactggagagaaaccttatagatgtgaagagtgtggc
aaagcctttttatgttccagagccctgaataaacataagacaattcatactggagagaaa
ccttacgaatgtgaagagtgtggcaaagcctttggatggtccacatacctgagtaaacat
aagaaaattcatactggagagaaaccttatagatgtgaagagtgtggcaaagcatttaga
cgttccagagtcctgaataaatataagacaattcatactggagataaaacccccaaatgt
aaaggatgtggcaaagcctttaagtggtcctcataccttaatcaacataataaaatttat
actggagagaaactctag

DBGET integrated database retrieval system