KEGG   Homo sapiens (human): 6545Help
Entry
6545              CDS       T01001                                 

Gene name
SLC7A4, CAT-4, CAT4, HCAT3, VH
Definition
(RefSeq) solute carrier family 7 member 4
  KO
K13866  solute carrier family 7 (cationic amino acid transporter), member 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6545 (SLC7A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   6545 (SLC7A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Mit_proteolip DUF2417
Motif
Other DBs
NCBI-GeneID: 6545
NCBI-ProteinID: NP_004164
OMIM: 603752
HGNC: 11062
Ensembl: ENSG00000099960
Vega: OTTHUMG00000150896
Pharos: O43246(Tbio)
UniProt: O43246
Position
22q11.21
AA seq 635 aa AA seqDB search
MARGLPTIASLARLCQKLNRLKPLEDSTMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTG
AVAKEVAGPAVLLSFGVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGELWAFLIGW
NVLLEYIIGGAAVARAWSGYLDSMFSHSIRNFTETHVGSWQVPLLGHYPDFLAAGIILLA
SAFVSCGARVSSWLNHTFSAISLLVILFIVILGFILAQPHNWSADEGGFAPFGFSGVMAG
TASCFYAFVGFDVIAASSEEAQNPRRSVPLAIAISLAIAAGAYILVSTVLTLMVPWHSLD
PDSALADAFYQRGYRWAGFIVAAGSICAMNTVLLSLLFSLPRIVYAMAADGLFFQVFAHV
HPRTQVPVAGTLAFGLLTAFLALLLDLESLVQFLSLGTLLAYTFVATSIIVLRFQKSSPP
SSPGPASPGPLTKQQSSFSDHLQLVGTVHASVPEPGELKPALRPYLGFLDGYSPGAVVTW
ALGVMLASAITIGCVLVFGNSTLHLPHWGYILLLLLTSVMFLLSLLVLGAHQQQYREDLF
QIPMVPLIPALSIVLNICLMLKLSYLTWVRFSIWLLMGLAVYFGYGIRHSKENQRELPGL
NSTHYVVFPRGSLEETVQAMQPPSQAPAQDPGHME
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggggctgcccaccattgctagcctggcacgcttatgccagaagctgaaccgc
ctgaagccgctggaggactccaccatggagacgtcactgcggcgctgcctgtccacgctg
gacctgactcttctgggcgtgggtggcatggtgggctcgggtctctacgtgctcacaggt
gccgtggccaaggaggtggctggccctgctgtgctcttgtccttcggtgtggccgctgtg
gcctccctgctggcagccctatgctatgcagaatttggggcacgtgtgccacgcacgggc
tctgcctacctgttcacctacgtatccatgggcgagctgtgggccttcctcatcggctgg
aatgttctcctcgaatacatcatcggtggcgccgccgtggcccgtgcctggagtggctac
ctggactctatgttcagccacagcatccgcaacttcactgagacccacgtgggttcttgg
caggtgcccctcctgggccactacccggacttcctggctgctggcatcatcctcctggcc
tctgcctttgtctcctgtggagcccgcgtgtcctcctggctcaatcacaccttctcggcc
atcagcctgcttgtcattctcttcattgtcatcctgggcttcatcctggcccagcctcac
aactggagcgctgacgaaggcggctttgcacccttcggcttctccggcgtcatggccggc
actgcctcctgcttctatgctttcgtgggcttcgacgtcattgccgcctccagtgaggag
gcccagaacccacggcggtctgtgcctctggccatcgccatctcgcttgccattgcagct
ggtgcctacatccttgtctccaccgtgctaaccctcatggtgccctggcacagcctggac
cccgactcagcgcttgcagatgccttctaccagcggggctacaggtgggctggcttcatc
gtggcagctggctccatctgcgccatgaacaccgtcctgctcagcctcctcttctccctg
ccacgcattgtctatgccatggccgccgatgggctcttcttccaggtgtttgcccatgtg
cacccccggacacaggtgcctgtggcgggcaccctggcgttcgggctcctcacggccttc
ctggcactgctgctggacctggagtcgctggttcagttcctgtcccttggcacactcctg
gcctacacattcgtggccaccagtatcattgtgctgcgcttccagaagtcttccccgccc
agctccccaggcccagccagccctggccccctgaccaagcagcagagctccttctcagac
cacctacagctggtgggcactgtacacgcctccgtccctgagccaggggagctgaagcca
gccctgaggccctacctgggcttcttggatgggtacagccctggagcagtggtgacttgg
gcgcttggcgttatgttggcctcagccatcaccataggctgcgtgcttgtctttgggaac
tcgaccctgcacctcccacactggggttacatcctgctgctcctgctcaccagtgtcatg
tttctgctcagcctccttgtcctgggggctcaccagcaacagtatcgggaagacttattt
cagatccccatggttcccctgattccagccctgagcatcgtcctcaacatctgcctcatg
ctgaaacttagctatctgacctgggtgcgcttctccatctggctgctgatgggacttgca
gtgtatttcggctatggcatccggcatagcaaggagaaccagcgggagctgccagggctg
aactccacacactacgtggtattccccaggggcagcctggaggagacagtgcaggctatg
cagccccccagccaggcaccagcacaggaccctggccatatggagtag

DBGET integrated database retrieval system