KEGG   Homo sapiens (human): 6548Help
Entry
6548              CDS       T01001                                 

Gene name
SLC9A1, APNH, LIKNS, NHE-1, NHE1, PPP1R143
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04919  Thyroid hormone signaling pathway
hsa04970  Salivary secretion
hsa04971  Gastric acid secretion
hsa04972  Pancreatic secretion
hsa04976  Bile secretion
hsa05205  Proteoglycans in cancer
Disease
H01891  Autosomal recessive spinocerebellar ataxias
Drug target
Cariporide mesylate: D03406
Zoniporide mesylate: D09036
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    6548 (SLC9A1)
   04024 cAMP signaling pathway
    6548 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6548 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    6548 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    6548 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    6548 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    6548 (SLC9A1)
   04971 Gastric acid secretion
    6548 (SLC9A1)
   04972 Pancreatic secretion
    6548 (SLC9A1)
   04976 Bile secretion
    6548 (SLC9A1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    6548 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    6548 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6548 (SLC9A1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     6548 (SLC9A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC9: Na+/H+ exchanger
   6548 (SLC9A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Motif
Other DBs
NCBI-GeneID: 6548
NCBI-ProteinID: NP_003038
OMIM: 107310
HGNC: 11071
Ensembl: ENSG00000090020
Vega: OTTHUMG00000004271
Pharos: P19634(Tchem)
UniProt: P19634 B2RAH2
Structure
PDB: 

Position
1p36.11
AA seq 815 aa AA seqDB search
MVLRSGICGLSPHRIFPSLLVVVALVGLLPVLRSHGLQLSPTASTIRSSEPPRERSIGDV
TTAPPEVTPESRPVNHSVTDHGMKPRKAFPVLGIDYTHVRTPFEISLWILLACLMKIGFH
VIPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLR
QFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQINNIGLLDNLLFGSIISAVDPV
AVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFV
VALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASG
VVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLF
CLIARVLGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCDLF
LTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGH
YGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSA
VSTVSMQNIHPKSLPSERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYE
EAWNQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKEDLPVITID
PASPQSPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTP
APSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKGQ
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggttctgcggtctggcatctgtggcctctctccacatcggatcttcccttccttactc
gtggtggttgctttggtggggctgctgcctgttctcaggagccatggcctccagctcagc
ccaactgccagcaccattcgaagctcagagccaccacgagaacgctcgattggggatgtc
accaccgctccaccggaggtcaccccagagagccgccctgttaatcattccgtcactgat
catggcatgaagccgcgcaaggcctttccagtcctgggcatcgactacacacacgtgcgc
acccccttcgagatctccctctggatccttctggcctgcctcatgaagataggtttccat
gtgatccccactatctcaagcatcgtcccggagagctgcctgctgatcgtggtggggctg
ctggtggggggcctgatcaagggtgtaggcgagacaccccccttcctgcagtccgacgtc
ttcttcctcttcctgctgccgcccatcatcctggatgcgggctacttcctgccactgcgg
cagttcacagaaaacctgggcaccatcctgatctttgccgtggtgggcacgctgtggaac
gccttcttcctgggcggcctcatgtacgccgtgtgcctggtgggcggtgagcagatcaac
aacatcggcctcctggacaacctgctcttcggcagcatcatctcggccgtggaccccgtg
gcggttctggctgtctttgaggaaattcacatcaatgagctgctgcacatccttgttttt
ggggagtccttgctcaatgacgccgtcactgtggtcctgtatcacctctttgaggagttt
gccaactacgaacacgtgggcatcgtggacatcttcctcggcttcctgagcttcttcgtg
gtggccctgggcggggtgcttgtgggcgtggtctacggggtcatcgcagccttcacctcc
cgatttacctcccacatccgggtcatcgagccgctcttcgtcttcctctacagctacatg
gcctacttgtcagccgagctcttccacctgtcaggcatcatggcgctcatagcctcagga
gtggtgatgcgcccctatgtggaggccaacatctcccacaagtcccacaccaccatcaaa
tacttcctgaagatgtggagcagcgtcagcgagaccctcatcttcatcttcctcggcgtc
tccacggtggccggctcccaccactggaactggaccttcgtcatcagcaccctgctcttc
tgcctcatcgcccgcgtgctgggggtgctgggcctgacctggttcatcaacaagttccgt
atcgtgaagctgacccccaaggaccagttcatcatcgcctatgggggcctgcgaggggcc
atcgccttctctctgggctacctcctggacaagaagcacttccccatgtgtgacctgttc
ctcactgccatcatcactgtcatcttcttcaccgtctttgtgcagggcatgaccattcgg
cccctggtagacctgttggctgtgaagaaaaagcaagagacgaagcgctccatcaacgaa
gagatccacacacagttcctggaccaccttctgacaggcatcgaagacatctgtggccac
tacggtcaccaccactggaaggacaagctcaaccggtttaataagaaatatgtgaagaag
tgtctgatagctggcgagcgctccaaggagccccagctcattgccttctaccacaagatg
gagatgaagcaggccatcgagctggtggagagcgggggcatgggcaagatcccctctgcc
gtctccaccgtctccatgcagaacatccaccccaagtccctgccttccgagcgcatcctg
ccagcactgtccaaggacaaggaggaggagatccgcaaaatcctgaggaacaacttgcag
aagaccaggcagcggctgcggtcctacaacagacacacgctggtggcagacccctacgag
gaagcctggaaccagatgctgctccggaggcagaaggcccggcagctggagcagaagatc
aacaactacctgacggtgccagcccacaagctggactcacccaccatgtctcgggcccgc
atcggctcagacccactggcctatgagccgaaggaggacctgcctgtcatcaccatcgac
ccggcttccccgcagtcacccgagtctgtggacctggtgaatgaagagctgaagggcaaa
gtcttagggttgagccgggatcctgcaaaggtggctgaggaggacgaggacgacgatggg
ggcatcatgatgcggagcaaggagacttcgtccccaggaaccgacgatgtcttcaccccc
gcgcccagtgacagccccagctcccagaggatacagcgctgcctcagtgacccaggccca
caccctgagcctggggagggagaaccgttcttccccaaggggcagtaa

DBGET integrated database retrieval system