KEGG   Homo sapiens (human): 6549Help
Entry
6549              CDS       T01001                                 

Gene name
SLC9A2, NHE2
Definition
(RefSeq) solute carrier family 9 member A2
  KO
K14722  solute carrier family 9 (sodium/hydrogen exchanger), member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6549 (SLC9A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   6549 (SLC9A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Na_H_Exchanger NEXCaM_BD
Motif
Other DBs
NCBI-GeneID: 6549
NCBI-ProteinID: NP_003039
OMIM: 600530
HGNC: 11072
Ensembl: ENSG00000115616
Vega: OTTHUMG00000130778
Pharos: Q9UBY0(Tbio)
UniProt: Q9UBY0
Position
2q12.1
AA seq 812 aa AA seqDB search
MEPLGNWRSLRAPLPPMLLLLLLQVAGPVGALAETLLNAPRAMGTSSSPPSPASVVAPGT
TLFEESRLPVFTLDYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLL
LGGIIFGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWN
SIGIGVSLFGICQIEAFGLSDITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVF
GESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFVVGIGGVLIGIFLGFIAAFTT
RFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIK
YFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRFR
TIPLTFKDQFIIAYGGLRGAICFALVFLLPAAVFPRKKLFITAAIVVIFFTVFILGITIR
PLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRK
LLIRENQPKSSIVSLYKKLEIKHAIEMAETGMISTVPTFASLNDCREEKIRKVTSSETDE
IRELLSRNLYQIRQRTLSYNRHSLTADTSERQAKEILIRRRHSLRESIRKDSSLNREHRA
STSTSRYLSLPKNTKLPEKLQKRRTISIADGNSSDSDADAGTTVLNLQPRARRFLPEQFS
KKSPQSYKMEWKNEVDVDSGRDMPSTPPTPHSREKGTQTSGLLQQPLLSKDQSGSEREDS
LTEGIPPKPPPRLVWRASEPGSRKARFGSEKP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggaaccactgggcaactggaggagcctgcgggcgccactgcctccgatgctgttgctg
ctgctcctgcaggtggcggggcccgtgggcgccctggcggagaccttgctgaacgcgccg
agggccatgggcaccagttccagcccgcctagccctgcgagcgtggtggctcccggaacg
acgctgttcgaggagagccggctgcctgtgtttacgctggattacccccacgtgcagatc
cccttcgagatcaccctttggatcctgctggcctccctggccaagattggcttccatctg
tatcacaagttgcccacaatagtgcctgagagctgccttcttataatggttggacttcta
ctaggtgggattatttttggtgttgatgagaagtctccccctgcaatgaagactgatgta
tttttcttgtacctcctcccacccatcgtgctggatgccggctatttcatgcccactcgc
ccattctttgagaacattggcacgattttctggtatgctgtggtagggacactttggaat
tccattggcattggggtgtctttgtttggtatctgccagatcgaagcattcggcctcagc
gacatcactttgctccagaacctgctctttggcagcttaatctcagctgtcgatcctgtg
gctgtgcttgctgtctttgagaacattcacgtcaatgagcagctctacatcctggtcttt
ggagagtccctgctgaatgatgcagtaacagtggtcctgtacaacttgttcaagtcgttt
tgccagatgaaaaccattgagaccattgatgtgtttgcaggaatcgccaacttctttgtt
gtgggaatcggtggggtgctgattggcatcttcttgggctttatagcggcatttactact
cgattcacccataatatccgagtgatcgagccactgtttgttttcctgtacagttatttg
tcctacatcacagctgaaatgtttcacctctcaggcatcatggcaatcactgcttgtgca
atgactatgaataagtacgtagaagaaaatgtatctcagaaatcctacacgaccatcaag
tacttcatgaagatgctgagcagtgtcagcgaaaccttgatcttcatcttcatgggtgtg
tctaccgtgggcaagaaccacgagtggaactgggccttcgtctgcttcaccctggccttc
tgcctcatgtggcgagccctgggtgtttttgtcctgactcaggtcattaataggttccgg
accattcccctgacctttaaggaccagttcatcattgcctatggaggacttcgaggtgcc
atctgttttgcgttagtgtttctccttcctgctgctgtgtttcctcggaaaaaattgttt
attacggctgccattgttgtcatattctttactgtcttcattctgggaataactattcga
ccactggtggagtttcttgatgtcaagaggtccaataagaaacaacaagctgtcagtgaa
gaaatctattgtcggttgtttgatcatgtgaagactggaattgaagatgtttgtggacat
tggggtcacaacttttggagagacaagtttaagaagtttgatgataaatatctgcggaag
cttttgattcgggaaaaccaaccaaagtcaagtattgtatctttatataaaaagcttgaa
ataaaacatgccattgagatggcagagactgggatgataagtactgtccctacatttgca
tctctaaatgattgtcgtgaagaaaaaataaggaaggtcacgtccagtgaaactgatgaa
attcgagaactcttatcaagaaatctctatcaaatccgtcagcgaactttatcctacaac
agacacagtctgacagccgacacaagtgagagacaagccaaggagattctgattcgccgg
cgacacagtttgcgagaaagcattaggaaggacagcagcttgaatcgagaacacagggct
tccacttcaacctcccgatatttatccttacctaaaaatacgaagcttccagaaaagcta
caaaagaggaggactatttctattgcagatggcaatagcagcgactcagacgcagatgcc
gggaccaccgtgctcaatttgcagcccagagccaggcgcttcttgccagaacagttctcc
aagaaatccccccagtcctataaaatggaatggaagaatgaggtagatgttgattctggc
cgagatatgcccagcacccccccaacaccccacagcagagaaaagggcacccagacgtca
ggcttactacagcagccccttctctctaaagaccagtctggctcagagagggaagacagt
ttgactgaaggcatcccgcccaagccgccaccacggctggtctggagggcatcggaacct
ggaagccggaaagcccgatttgggagtgagaagccttaa

DBGET integrated database retrieval system