KEGG   Homo sapiens (human): 655
Entry
655               CDS       T01001                                 

Symbol
BMP7, OP-1
Name
(RefSeq) bone morphogenetic protein 7
  KO
K16621  bone morphogenetic protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    655 (BMP7)
   04390 Hippo signaling pathway
    655 (BMP7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    655 (BMP7)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    655 (BMP7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    655 (BMP7)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    655 (BMP7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   655 (BMP7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   655 (BMP7)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 655
NCBI-ProteinID: NP_001710
OMIM: 112267
HGNC: 1074
Ensembl: ENSG00000101144
Vega: OTTHUMG00000032812
Pharos: P18075(Tbio)
UniProt: P18075 A8K571
Structure
PDB: 
1LXI 1M4U 1BMP 1LX5

Position
20q13.31
AA seq 431 aa
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgcacgtgcgctcactgcgagctgcggcgccgcacagcttcgtggcgctctgggcaccc
ctgttcctgctgcgctccgccctggccgacttcagcctggacaacgaggtgcactcgagc
ttcatccaccggcgcctccgcagccaggagcggcgggagatgcagcgcgagatcctctcc
attttgggcttgccccaccgcccgcgcccgcacctccagggcaagcacaactcggcaccc
atgttcatgctggacctgtacaacgccatggcggtggaggagggcggcgggcccggcggc
cagggcttctcctacccctacaaggccgtcttcagtacccagggcccccctctggccagc
ctgcaagatagccatttcctcaccgacgccgacatggtcatgagcttcgtcaacctcgtg
gaacatgacaaggaattcttccacccacgctaccaccatcgagagttccggtttgatctt
tccaagatcccagaaggggaagctgtcacggcagccgaattccggatctacaaggactac
atccgggaacgcttcgacaatgagacgttccggatcagcgtttatcaggtgctccaggag
cacttgggcagggaatcggatctcttcctgctcgacagccgtaccctctgggcctcggag
gagggctggctggtgtttgacatcacagccaccagcaaccactgggtggtcaatccgcgg
cacaacctgggcctgcagctctcggtggagacgctggatgggcagagcatcaaccccaag
ttggcgggcctgattgggcggcacgggccccagaacaagcagcccttcatggtggctttc
ttcaaggccacggaggtccacttccgcagcatccggtccacggggagcaaacagcgcagc
cagaaccgctccaagacgcccaagaaccaggaagccctgcggatggccaacgtggcagag
aacagcagcagcgaccagaggcaggcctgtaagaagcacgagctgtatgtcagcttccga
gacctgggctggcaggactggatcatcgcgcctgaaggctacgccgcctactactgtgag
ggggagtgtgccttccctctgaactcctacatgaacgccaccaaccacgccatcgtgcag
acgctggtccacttcatcaacccggaaacggtgcccaagccctgctgtgcgcccacgcag
ctcaatgccatctccgtcctctacttcgatgacagctccaacgtcatcctgaagaaatac
agaaacatggtggtccgggcctgtggctgccactag

DBGET integrated database retrieval system