KEGG   Homo sapiens (human): 6565
Entry
6565              CDS       T01001                                 

Symbol
SLC15A2, PEPT2
Name
(RefSeq) solute carrier family 15 member 2
  KO
K14637  solute carrier family 15 (oligopeptide transporter), member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6565 (SLC15A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   6565 (SLC15A2)
SSDB
Motif
Pfam: PTR2 DUF4397 DUF3093
Other DBs
NCBI-GeneID: 6565
NCBI-ProteinID: NP_066568
OMIM: 602339
HGNC: 10921
Ensembl: ENSG00000163406
Vega: OTTHUMG00000159423
Pharos: Q16348(Tbio)
UniProt: Q16348
Position
3q13.33
AA seq 729 aa
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL
NT seq 2190 nt   +upstreamnt  +downstreamnt
atgaatcctttccagaaaaatgagtccaaggaaactcttttttcacctgtctccattgaa
gaggtaccacctcgaccacctagccctccaaagaagccatctccgacaatctgtggctcc
aactatccactgagcattgccttcattgtggtgaatgaattctgcgagcgcttttcctat
tatggaatgaaagctgtgctgatcctgtatttcctgtatttcctgcactggaatgaagat
acctccacatctatataccatgccttcagcagcctctgttattttactcccatcctggga
gcagccattgctgactcgtggttgggaaaattcaagacaatcatctatctctccttggtg
tatgtgcttggccatgtgatcaagtccttgggtgccttaccaatactgggaggacaagtg
gtacacacagtcctatcattgatcggcctgagtctaatagctttggggacaggaggcatc
aaaccctgtgtggcagcttttggtggagaccagtttgaagaaaaacatgcagaggaacgg
actagatacttctcagtcttctacctgtccatcaatgcagggagcttgatttctacattt
atcacacccatgctgagaggagatgtgcaatgttttggagaagactgctatgcattggct
tttggagttccaggactgctcatggtaattgcacttgttgtgtttgcaatgggaagcaaa
atatacaataaaccaccccctgaaggaaacatagtggctcaagttttcaaatgtatctgg
tttgctatttccaatcgtttcaagaaccgttctggagacattccaaagcgacagcactgg
ctagactgggcggctgagaaatatccaaagcagctcattatggatgtaaaggcactgacc
agggtactattcctttatatcccattgcccatgttctgggctcttttggatcagcagggt
tcacgatggactttgcaagccatcaggatgaataggaatttggggttttttgtgcttcag
ccggaccagatgcaggttctaaatccccttctggttcttatcttcatcccgttgtttgac
tttgtcatttatcgtctggtctccaagtgtggaattaacttctcatcacttaggaaaatg
gctgttggtatgatcctagcatgcctggcatttgcagttgcggcagctgtagagataaaa
ataaatgaaatggccccagcccagccaggtccccaggaggttttcctacaagtcttgaat
ctggcagatgatgaggtgaaggtgacagtggtgggaaatgaaaacaattctctgttgata
gagtccatcaaatcctttcagaaaacaccacactattccaaactgcacctgaaaacaaaa
agccaggattttcacttccacctgaaatatcacaatttgtctctctacactgagcattct
gtgcaggagaagaactggtacagtcttgtcattcgtgaagatgggaacagtatctccagc
atgatggtaaaggatacagaaagcagaacaaccaatgggatgacaaccgtgaggtttgtt
aacactttgcataaagatgtcaacatctccctgagtacagatacctctctcaatgttggt
gaagactatggtgtgtctgcttatagaactgtgcaaagaggagaataccctgcagtgcac
tgtagaacagaagataagaacttttctctgaatttgggtcttctagactttggtgcagca
tatctgtttgttattactaataacaccaatcagggtcttcaggcctggaagattgaagac
attccagccaacaaaatgtccattgcgtggcagctaccacaatatgccctggttacagct
ggggaggtcatgttctctgtcacaggtcttgagttttcttattctcaggctccctctagc
atgaaatctgtgctccaggcagcttggctattgacaattgcagttgggaatatcatcgtg
cttgttgtggcacagttcagtggcctggtacagtgggccgaattcattttgttttcctgc
ctcctgctggtgatctgcctgatcttctccatcatgggctactactatgttcctgtaaag
acagaggatatgcggggtccagcagataagcacattcctcacatccaggggaacatgatc
aaactagagaccaagaagacaaaactctga

DBGET integrated database retrieval system