KEGG   Homo sapiens (human): 6566Help
Entry
6566              CDS       T01001                                 

Gene name
SLC16A1, HHF7, MCT, MCT1, MCT1D
Definition
(RefSeq) solute carrier family 16 member 1
  KO
K08179  MFS transporter, MCT family, solute carrier family 16 (monocarboxylic acid transporters), member 1
Organism
hsa  Homo sapiens (human)
Disease
H01248  Erythrocyte lactate transporter defect
H01267  Familial hyperinsulinemic hypoglycemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6566 (SLC16A1)
   04147 Exosome [BR:hsa04147]
    6566 (SLC16A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC16: Monocarboxylate transporter
   6566 (SLC16A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Monocarboxylate transporter (MCT) family [TC:2.A.1.13]
    6566 (SLC16A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   6566 (SLC16A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 CbtA TMEMspv1-c74-12
Motif
Other DBs
NCBI-GeneID: 6566
NCBI-ProteinID: NP_001159968
OMIM: 600682
HGNC: 10922
Ensembl: ENSG00000155380
Vega: OTTHUMG00000012129
Pharos: P53985(Tchem)
UniProt: P53985 A0A024R0H1 B4DKS0
Position
1p13.2
AA seq 500 aa AA seqDB search
MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagcagttggaggtccagttggatacacccccccagatggaggctggggctgg
gcagtggtaattggagctttcatttccatcggcttctcttatgcatttcccaaatcaatt
actgtcttcttcaaagagattgaaggtatattccatgccaccaccagcgaagtgtcatgg
atatcctccataatgttggctgtcatgtatggtggaggtcctatcagcagtatcctggtg
aataaatatggaagtcgtatagtcatgattgttggtggctgcttgtcaggctgtggcttg
attgcagcttctttctgtaacaccgtacagcaactatacgtctgtattggagtcattgga
ggtcttgggcttgccttcaacttgaatccagctctgaccatgattggcaagtatttctac
aagaggcgaccattggccaacggactggccatggcaggcagccctgtgttcctctgtact
ctggcccccctcaatcaggttttcttcggtatctttggatggagaggaagctttctaatt
cttgggggcttgctactaaactgctgtgttgctggagccctcatgcgaccaatcgggccc
aagccaaccaaggcagggaaagataagtctaaagcatcccttgagaaagctggaaaatct
ggtgtgaaaaaagatctgcatgatgcaaatacagatcttattggaagacaccctaaacaa
gagaaacgatcagtcttccaaacaattaatcagttcctggacttaaccctattcacccac
agaggctttttgctatacctctctggaaatgtgatcatgttttttggactctttgcacct
ttggtgtttcttagtagttatgggaagagtcagcattattctagtgagaagtctgccttc
cttctttccattctggcttttgttgacatggtagcccgaccatctatgggacttgtagcc
aacacaaagccaataagacctcgaattcagtatttctttgcggcttccgttgttgcaaat
ggagtgtgtcatatgctagcacctttatccactacctatgttggattctgtgtctatgcg
ggattctttggatttgccttcgggtggctcagctccgtattgtttgaaacattgatggac
cttgttggaccccagaggttctccagcgctgtgggattggtgaccattgtggaatgctgt
cctgtcctcctggggccaccacttttaggtcggctcaatgacatgtatggagactacaaa
tacacatactgggcatgtggcgtcgtcctaattatttcaggtatctatctcttcattggc
atgggcatcaattatcgacttttggcaaaagaacagaaagcaaacgagcagaaaaaggaa
agtaaagaggaagagaccagtatagatgttgctgggaagccaaatgaagttaccaaagca
gcagaatctccggaccagaaagacacagatggagggcccaaggaggaggaaagtccagtc
tga

DBGET integrated database retrieval system