KEGG   Homo sapiens (human): 6568Help
Entry
6568              CDS       T01001                                 

Gene name
SLC17A1, NAPI-1, NPT-1, NPT1
Definition
(RefSeq) solute carrier family 17 member 1
  KO
K12300  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 1/2/3/4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6568 (SLC17A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   6568 (SLC17A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    6568 (SLC17A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 6568
NCBI-ProteinID: NP_005065
OMIM: 182308
HGNC: 10929
Ensembl: ENSG00000124568
Vega: OTTHUMG00000016297
Pharos: Q14916(Tbio)
UniProt: Q14916
Position
6p22.2
AA seq 467 aa AA seqDB search
MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTS
TKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSV
LSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLL
GPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSS
TFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI
LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatggataaccggttgcctcccaaaaaagttccaggtttctgttcctttcgctat
ggattgtctttccttgtgcactgttgtaatgttataataacagcacagcgtgcgtgcctg
aacctcacaatggtagtcatggtgaatagcacagatccacatggtttgcccaacacctcc
acaaagaagctcctggataatataaagaaccctatgtataattggagcccagatatccag
ggaatcatcttgagttccacctcctatggtgtcatcatcatccaagttcctgttggatac
ttctctggaatatattctacaaagaaaatgattggctttgcattatgcctcagctctgtg
ttaagcctgctcatcccaccagcagctggaattggagtagcttgggtcgttgtatgtcga
gcagttcagggagcagcccaggggatagttgcaacagcccagtttgaaatatatgtcaaa
tgggctcctcccctggaacgaggccgacttacttctatgagtacatcagggtttttgctg
ggaccctttattgtcctacttgtgactggagttatctgtgaatctctgggctggcccatg
gtcttctatatttttggtgcttgtggctgtgccgtatgtcttctctggttcgttctgttt
tatgatgaccccaaagaccacccatgtataagcatcagtgaaaaggaatacatcacatcc
tccctggtccagcaggtcagttcaagtagacaatctctgcctatcaaggctatacttaag
tcgcttccagtctgggctatttccactggtagttttacgtttttctggtcacataacatc
atgacactatacactccaatgtttatcaactccatgcttcatgttaatataaaagagaat
gggttcttgtcttcccttccctatttgtttgcctggatctgtggtaacctagcaggtcag
ttatcagacttcttcctgaccaggaatattctcagcgtaattgctgtccggaaactcttc
acagcagcaggatttctccttcctgcaatctttggtgtctgcctgccttacctgagttcc
accttctacagcattgtcattttcctaatacttgctggtgcaacaggcagcttttgcttg
ggtggagtgtttataaatggcttggatattgctcccagatattttggatttattaaagca
tgttcaactttaactggaatgataggaggactaattgcttccactttgactggattgatc
cttaagcaggatccggaatccgcctggtttaaaaccttcatcctgatggcagccattaat
gtgactggcctaattttctaccttatagttgctacagcagaaattcaggactgggctaaa
gaaaaacaacacacacgtctctga

DBGET integrated database retrieval system