KEGG   Homo sapiens (human): 6569
Entry
6569              CDS       T01001                                 

Gene name
SLC34A1, FRTS2, HCINF2, NAPI-3, NPHLOP1, NPT2, NPTIIa, SLC11, SLC17A2
Definition
(RefSeq) solute carrier family 34 member 1
  KO
K14683  solute carrier family 34 (sodium-dependent phosphate cotransporter)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04978  Mineral absorption
Disease
H00888  Nephrolithiasis/osteoporosis, hypophosphatemic
H01198  Fanconi renotubular syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    6569 (SLC34A1)
  09154 Digestive system
   04978 Mineral absorption
    6569 (SLC34A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6569 (SLC34A1)
   04147 Exosome [BR:hsa04147]
    6569 (SLC34A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC34: Type II Na+-phosphate cotransporter
   6569 (SLC34A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   6569 (SLC34A1)
SSDB
Motif
Pfam: Na_Pi_cotrans
Other DBs
NCBI-GeneID: 6569
NCBI-ProteinID: NP_003043
OMIM: 182309
HGNC: 11019
Ensembl: ENSG00000131183
Vega: OTTHUMG00000130857
Pharos: Q06495(Tbio)
UniProt: Q06495 A0A024R7R9 Q7Z725 Q86VN6
Position
5q35.3
AA seq 639 aa
MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEH
TCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLKVPLMLTFLYLFVCSLDM
LSSAFQLAGGKVAGDIFKDNAILSNPVAGLVVGILVTVLVQSSSTSTSIIVSMVSSGLLE
VSSAIPIIMGSNIGTSVTNTIVALMQAGDRTDFRRAFAGATVHDCFNWLSVLVLLPLEAA
TGYLHHITRLVVASFNIHGGRDAPDLLKIITEPFTKLIIQLDESVITSIATGDESLRNHS
LIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLPDLAVGLILLAGSLV
LLCTCLILLVKMLNSLLKGQVAKVIQKVINTDFPAPFTWVTGYFAMVVGASMTFVVQSSS
VFTSAITPLIGLGVISIERAYPLTLGSNIGTTTTAILAALASPREKLSSAFQIALCHFFF
NISGILLWYPVPCTRLPIRMAKALGKRTAKYRWFAVLYLLVCFLLLPSLVFGISMAGWQV
MVGVGTPFGALLAFVVLINVLQSRSPGHLPKWLQTWDFLPRWMHSLKPLDHLITRATLCC
ARPEPRSPPLPPRVFLEELPPATPSPRLALPAHHNATRL
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgttgtcctacggagagaggctggggtcccctgctgtctccccactcccagtccgtggg
gggcatgtgatgcgagggacggcctttgcctacgtgcccagccctcaggtcctacacagg
atcccggggacctctgcctatgccttccccagcctgggccctgtggcccttgctgagcac
acctgcccctgtggggaggtcctggagcgccatgaaccactgcctgccaagctggccctg
gaggaggagcagaagccagagtccaggctggtccccaagctgcgccaggctggcgccatg
ctgctcaaggtgccactgatgctcaccttcctctacctcttcgtctgctccctggacatg
ctcagctcggccttccagctggctggagggaaggtggctggtgacatcttcaaggataac
gccatcctgtccaacccggtggccgggctggtggtggggatcctggtgaccgtgctggtg
cagagctccagcacctccacatccatcatcgtcagcatggtctcctctggcttgctggag
gtgagctctgccatccccatcatcatgggctccaacatcggcacctctgtcaccaacacc
atcgtggccctgatgcaggcgggggacaggactgacttccggcgggccttcgcgggggcc
acggtgcatgactgctttaactggctgtcagtgctggtcctgctgcccctggaggctgcc
actggctacctgcaccacatcactcgacttgtggtggcctccttcaacatccatggtggc
cgtgatgctcctgacctgctcaagatcatcacagagcccttcacgaagctcatcatccag
ctggacgagtctgtgataaccagcattgccactggtgatgagtccctgaggaaccacagt
ctcatccagatctggtgccacccagactccttacaggctcccacctccatgtccagagca
gaggccaactccagccagacccttggaaatgccaccatggagaaatgcaaccacatcttt
gtggacactggcctaccggacctggctgtggggctcatcctgctggcaggatccctggtg
ctgctgtgcacctgcctcatcctcctagtcaagatgctcaactccctgctcaagggccaa
gtggccaaggtcatccagaaggtcatcaatacggacttccctgcccccttcacctgggtc
acaggctactttgccatggtggtgggcgccagcatgaccttcgtggtccagagcagttct
gtgttcacctcggccatcaccccactcatcggtcttggtgtgatcagcattgagagggcc
tacccgctcacactgggttccaacatcggcaccaccaccacggccatcctggctgccctg
gccagccccagggagaagctgtccagcgctttccagattgccctctgtcacttcttcttc
aacatctcgggtatccttctgtggtacccggtgccctgcacacgcctgcccatccgcatg
gccaaggcgctggggaaacgcacggccaagtaccgctggtttgccgtcctctatctcctt
gtctgcttcctgctgctgccctcactggtgtttggcatctccatggcaggctggcaggtc
atggtaggtgtgggcacgcccttcggggccctgctggccttcgtggtgctcatcaatgtc
ctgcagagtcggagtcccgggcacctgcccaagtggttacagacatgggacttcctgcct
cgctggatgcactccctgaagcccctggaccacctcatcacccgcgccaccctatgctgt
gccaggcctgagccccgctcacccccgctgccccccagggtcttcctggaggagctaccc
cctgccacaccctccccccgtcttgcactgcctgctcaccacaatgccacccgcctctag

DBGET integrated database retrieval system