KEGG   Homo sapiens (human): 6570Help
Entry
6570              CDS       T01001                                 

Gene name
SLC18A1, CGAT, VAT1, VMAT1
Definition
(RefSeq) solute carrier family 18 member A1
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Drug target
Metamfetamine (DG00968): D02242 D08187
Reserpine: D00197
Tedatioxetine (DG01311): D10170 D10171
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    6570 (SLC18A1)
   04726 Serotonergic synapse
    6570 (SLC18A1)
   04721 Synaptic vesicle cycle
    6570 (SLC18A1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    6570 (SLC18A1)
  09165 Substance dependence
   05030 Cocaine addiction
    6570 (SLC18A1)
   05031 Amphetamine addiction
    6570 (SLC18A1)
   05034 Alcoholism
    6570 (SLC18A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6570 (SLC18A1)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC18: Vesicular amine transporter
   6570 (SLC18A1)
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6570 (SLC18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 DUF5529 CPP1-like DUF2070
Motif
Other DBs
NCBI-GeneID: 6570
NCBI-ProteinID: NP_001129163
OMIM: 193002
HGNC: 10934
Ensembl: ENSG00000036565
Vega: OTTHUMG00000097017
Pharos: P54219(Tchem)
UniProt: P54219 Q96GL6
Position
8p21.3
AA seq 525 aa AA seqDB search
MLRTILDAPQRLLKEGRASRQLVLVVVFVALLLDNMLFTVVVPIVPTFLYDMEFKEVNSS
LHLGHAGSSPHALASPAFSTIFSFFNNNTVAVEESVPSGIAWMNDTASTIPPPATEAISA
HKNNCLQGTGFLEEEITRVGVLFASKAVMQLLVNPFVGPLTNRIGYHIPMFAGFVIMFLS
TVMFAFSGTYTLLFVARTLQGIGSSFSSVAGLGMLASVYTDDHERGRAMGTALGGLALGL
LVGAPFGSVMYEFVGKSAPFLILAFLALLDGALQLCILQPSKVSPESAKGTPLFMLLKDP
YILVAAGSICFANMGVAILEPTLPIWMMQTMCSPKWQLGLAFLPASVSYLIGTNLFGVLA
NKMGRWLCSLIGMLVVGTSLLCVPLAHNIFGLIGPNAGLGLAIGMVDSSMMPIMGHLVDL
RHTSVYGSVYAIADVAFCMGFAIGPSTGGAIVKAIGFPWLMVITGVINIVYAPLCYYLRS
PPAKEEKLAILSQDCPMETRMYATQKPTKEFPLGEDSDEEPDHEE
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgctccggaccattctggatgctccccagcggttgctgaaggaggggagagcgtcccgg
cagctggtgctggtggtggtattcgtcgctttgctcctggacaacatgctgtttactgtg
gtggtgccaattgtgcccaccttcctatatgacatggagttcaaagaagtcaactcttct
ctgcacctcggccatgccggaagttccccacatgccctcgcctctcctgccttttccacc
atcttctccttcttcaacaacaacaccgtggctgttgaagaaagcgtacctagtggaata
gcatggatgaatgacactgccagcaccatcccacctccagccactgaagccatctcagct
cataaaaacaactgcttgcaaggcacaggtttcttggaggaagagattacccgggtcggg
gttctgtttgcttcaaaggctgtgatgcaacttctggtcaacccattcgtgggccctctc
accaacaggattggatatcatatccccatgtttgctggctttgttatcatgtttctctcc
acagttatgtttgctttttctgggacctatactctactctttgtggcccgaacccttcaa
ggcattggatcttcattttcatctgttgcaggtcttggaatgctggccagtgtctacact
gatgaccatgagagaggacgagccatgggaactgctctggggggcctggccttggggttg
ctggtgggagctccctttggaagtgtaatgtacgagtttgttgggaagtctgcacccttc
ctcatcctggccttcctggcactactggatggagcactccagctttgcatcctacagcct
tccaaagtctctcctgagagtgccaaggggactcccctctttatgcttctcaaagaccct
tacatcctggtggctgcagggtccatctgctttgccaacatgggggtggccatcctggag
cccacactgcccatctggatgatgcagaccatgtgctcccccaagtggcagctgggtcta
gctttcttgcctgccagtgtgtcctacctcattggcaccaacctctttggtgtgttggcc
aacaagatgggtcggtggctgtgttccctaatcgggatgctggtagtaggtaccagcttg
ctctgtgttcctctggctcacaatatttttggtctcattggccccaatgcagggcttggc
cttgccataggcatggtggattcttctatgatgcccatcatggggcacctggtggatcta
cgccacacctcggtgtatgggagtgtctacgccatcgctgatgtggctttttgcatgggc
tttgctataggtccatccaccggtggtgccattgtaaaggccatcggttttccctggctc
atggtcatcactggggtcatcaacatcgtctatgctccactctgctactacctgcggagc
cccccggcaaaggaagagaagcttgctattctgagtcaggactgccccatggagacccgg
atgtatgcaacccagaagcccacgaaggaatttcctctgggggaggacagtgatgaggag
cctgaccatgaggagtag

DBGET integrated database retrieval system