KEGG   Homo sapiens (human): 6571
Entry
6571              CDS       T01001                                 

Gene name
SLC18A2, PKDYS2, SVAT, SVMT, VAT2, VMAT2
Definition
(RefSeq) solute carrier family 18 member A2
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04726  Serotonergic synapse
hsa04728  Dopaminergic synapse
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Network
nt06422  Dopamine metabolism
nt06463  Parkinson disease
  Element
N01040  Transport of dopamine
N01041  Mutation-caused aberrant SNCA to transport of dopamine
Drug target
Amfetamine (DG00966): D02074<US> D07445<US>
Amphetamine aspartate monohydrate: D11622
Benzfetamine (DG01755): D07514 D07515<US>
Deutetrabenazine: D10701<US>
Dexamfetamine (DG00967): D02078<US> D03740
Dextroamphetamine saccharate: D11623
Isometheptene: D07097
Metamfetamine (DG00968): D02242<JP/US> D08187
Midomafetamine: D11172
Reserpine: D00197
Tedatioxetine (DG01311): D10170 D10171
Tetrabenazine: D08575<JP/US>
Valbenazine (DG02115): D10675 D10999<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    6571 (SLC18A2)
   04726 Serotonergic synapse
    6571 (SLC18A2)
   04721 Synaptic vesicle cycle
    6571 (SLC18A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    6571 (SLC18A2)
  09165 Substance dependence
   05030 Cocaine addiction
    6571 (SLC18A2)
   05031 Amphetamine addiction
    6571 (SLC18A2)
   05034 Alcoholism
    6571 (SLC18A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6571 (SLC18A2)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   6571 (SLC18A2)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6571 (SLC18A2)
SSDB
Motif
Pfam: MFS_1 Sugar_tr S_4TM
Other DBs
NCBI-GeneID: 6571
NCBI-ProteinID: NP_003045
OMIM: 193001
HGNC: 10935
Ensembl: ENSG00000165646
Vega: OTTHUMG00000019121
Pharos: Q05940(Tclin)
UniProt: Q05940
Position
10q25.3
AA seq 514 aa
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccctgagcgagctggcgctggtccgctggctgcaggagagccgccgctcgcggaag
ctcatcctgttcatcgtgttcctggcgctgctgctggacaacatgctgctcactgtcgtg
gtccccatcatcccaagttatctgtacagcattaagcatgagaagaatgctacagaaatc
cagacggccaggccagtgcacactgcctccatctcagacagcttccagagcatcttctcc
tattatgataactcgactatggtcaccgggaatgctaccagagacctgacacttcatcag
accgccacacagcacatggtgaccaacgcgtccgctgttccttccgactgtcccagtgaa
gacaaagacctcctgaatgaaaacgtgcaagttggtctgttgtttgcctcgaaagccacc
gtccagctcatcaccaaccctttcataggactactgaccaacagaattggctatccaatt
cccatatttgcgggattctgcatcatgtttgtctcaacaattatgtttgccttctccagc
agctatgccttcctgctgattgccaggtcgctgcagggcatcggctcgtcctgctcctct
gtggctgggatgggcatgcttgccagtgtctacacagatgatgaagagagaggcaacgtc
atgggaatcgccttgggaggcctggccatgggggtcttagtgggcccccccttcgggagt
gtgctctatgagtttgtggggaagacggctccgttcctggtgctggccgccctggtactc
ttggatggagctattcagctctttgtgctccagccgtcccgggtgcagccagagagtcag
aaggggacacccctaaccacgctgctgaaggacccgtacatcctcattgctgcaggctcc
atctgctttgcaaacatgggcatcgccatgctggagccagccctgcccatctggatgatg
gagaccatgtgttcccgaaagtggcagctgggcgttgccttcttgccagctagtatctct
tatctcattggaaccaatatttttgggatacttgcacacaaaatggggaggtggctttgt
gctcttctgggaatgataattgttggagtcagcattttatgtattccatttgcaaaaaac
atttatggactcatagctccgaactttggagttggttttgcaattggaatggtggattcg
tcaatgatgcctatcatgggctacctcgtagacctgcggcacgtgtccgtctatgggagt
gtgtacgccattgcggatgtggcattttgtatggggtatgctataggtccttctgctggt
ggtgctattgcaaaggcaattggatttccatggctcatgacaattattgggataattgat
attctttttgcccctctctgcttttttcttcgaagtccacctgccaaagaagaaaaaatg
gctattctcatggatcacaactgccctattaaaacaaaaatgtacactcagaataatatc
cagtcatatccgataggtgaagatgaagaatctgaaagtgactga

DBGET integrated database retrieval system