KEGG   Homo sapiens (human): 6572Help
Entry
6572              CDS       T01001                                 

Gene name
SLC18A3, CMS21, VACHT
Definition
(RefSeq) solute carrier family 18 member A3
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04725  Cholinergic synapse
Disease
H00770  Congenital myasthenic syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    6572 (SLC18A3)
   04721 Synaptic vesicle cycle
    6572 (SLC18A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6572 (SLC18A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   6572 (SLC18A3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    6572 (SLC18A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 BT1
Motif
Other DBs
NCBI-GeneID: 6572
NCBI-ProteinID: NP_003046
OMIM: 600336
HGNC: 10936
Ensembl: ENSG00000187714
Vega: OTTHUMG00000018196
Pharos: Q16572(Tchem)
UniProt: Q16572
Position
10q11.23
AA seq 532 aa AA seqDB search
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgcggaacctgcgggccaggcccgggcggcggccaccaagctgtcggaggct
gtgggcgcggcgctgcaggagccccggcggcagaggcgcctggtgcttgttatcgtgtgc
gtggcgctgttactggacaacatgctgtacatggtcatcgtgcccatagtgcccgactac
atcgcccacatgcgcgggggcggcgagggccccacccggactcccgaggtgtgggagccc
accctgccgctgcccactccggccaatgccagcgcctacacggccaacacctcggcgtcc
ccgacagctgcgtggccagcgggctcagcccttcggccccgctaccctacggagagcgaa
gacgtgaagatcggggtgctgtttgcttccaaggctatcctgcagctgctagtgaacccc
ttgagcgggcccttcatcgaccgcatgagctacgacgtgccgctgctgatcggcctgggc
gtcatgttcgcctctacagtcctgttcgccttcgccgaggactacgccacgctgttcgcg
gcgcgcagcctgcagggcctgggctcagccttcgccgacacgtctggcatagccatgatc
gccgataagtacccggaggagccggagcgcagtcgtgcactgggcgtggcgctggccttc
attagcttcggaagcctagtggccccgcccttcgggggcatcctctatgagttcgccggc
aagcgcgtgcccttcttggtgctagctgccgtgtcgctctttgacgcgctgttgctgctg
gcagtggccaaacccttctcggcggctgcacgggctcgggccaacctgccagtgggcact
cccatccaccgcctcatgctagacccctacattgccgtggtggccggcgcgctcaccacc
tgtaacattcccctcgccttcctcgaacccaccattgccacgtggatgaagcatacgatg
gcggcttccgagtgggagatgggcatggcctggctgccggccttcgtgcctcatgtgctg
ggcgtctacctcaccgtgcgcctggcggcgcgctacccacacctgcagtggctgtacggc
gcgcttgggctggctgtgatcggcgccagctcgtgcatcgtgcccgcctgccgctccttc
gcgccgctagtggtctcactatgcggcctctgttttggcatagccctagtcgacacagca
ctgctgcccacgctcgccttcctggtggacgtgcgccatgtctcagtctatggcagcgtc
tacgccatcgccgacatctcctattcggtggcctacgcgctcgggcccatagtggcaggc
cacattgtgcactcgctgggctttgagcagctcagccttggcatgggactggccaacctg
ctctatgctcccgtcttgctgctgctccgcaacgtgggcctcctgacgcgctcccgttcc
gagcgcgatgtgctgcttgatgagccaccgcaaggtctgtacgatgcggtgcgcctgcgt
gagcgtcctgtgtctggccaggacggcgagcctcgcagcccgcctggcccttttgatgcg
tgcgaggacgactacaactactactacacccgcagctag

DBGET integrated database retrieval system