KEGG   Homo sapiens (human): 6580Help
Entry
6580              CDS       T01001                                 

Gene name
SLC22A1, HOCT1, OCT1, oct1_cds
Definition
(RefSeq) solute carrier family 22 member 1
  KO
K08198  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04976  Bile secretion
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    6580 (SLC22A1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    6580 (SLC22A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6580 (SLC22A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   6580 (SLC22A1)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    6580 (SLC22A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 6580
NCBI-ProteinID: NP_003048
OMIM: 602607
HGNC: 10963
Ensembl: ENSG00000175003
Vega: OTTHUMG00000015947
Pharos: O15245(Tchem)
UniProt: O15245
Position
6q25.3
AA seq 554 aa AA seqDB search
MPTVDDILEQVGESGWFQKQAFLILCLLSAAFAPICVGIVFLGFTPDHHCQSPGVAELSQ
RCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGP
CQDGWVYDTPGSSIVTEFNLVCADSWKLDLFQSCLNAGFLFGSLGVGYFADRFGRKLCLL
GTVLVNAVSGVLMAFSPNYMSMLLFRLLQGLVSKGNWMAGYTLITEFVGSGSRRTVAIMY
QMAFTVGLVALTGLAYALPHWRWLQLAVSLPTFLFLLYYWCVPESPRWLLSQKRNTEAIK
IMDHIAQKNGKLPPADLKMLSLEEDVTEKLSPSFADLFRTPRLRKRTFILMYLWFTDSVL
YQGLILHMGATSGNLYLDFLYSALVEIPGAFIALITIDRVGRIYPMAMSNLLAGAACLVM
IFISPDLHWLNIIIMCVGRMGITIAIQMICLVNAELYPTFVRNLGVMVCSSLCDIGGIIT
PFIVFRLREVWQALPLILFAVLGLLAAGVTLLLPETKGVALPETMKDAENLGRKAKPKEN
TIYLKVQTSEPSGT
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccgtggatgacattctggagcaggttggggagtctggctggttccagaagcaa
gccttcctcatcttatgcctgctgtcggctgcctttgcgcccatctgtgtgggcatcgtc
ttcctgggtttcacacctgaccaccactgccagagtcctggggtggctgagctgagccag
cgctgtggctggagccctgcggaggagctgaactatacagtgccaggcctggggcccgcg
ggcgaggccttccttggccagtgcaggcgctatgaagtggactggaaccagagcgccctc
agctgtgtagaccccctggctagcctggccaccaacaggagccacctgccgctgggtccc
tgccaggatggctgggtgtatgacacgcccggctcttccatcgtcactgagttcaacctg
gtgtgtgctgactcctggaagctggacctctttcagtcctgtttgaatgcgggcttcttg
tttggctctctcggtgttggctactttgcagacaggtttggccgtaagctgtgtctcctg
ggaactgtgctggtcaacgcggtgtcgggcgtgctcatggccttctcgcccaactacatg
tccatgctgctcttccgcctgctgcagggcctggtcagcaagggcaactggatggctggc
tacaccctaatcacagaatttgttggctcgggctccagaagaacggtggcgatcatgtac
cagatggccttcacggtggggctggtggcgcttaccgggctggcctacgccctgcctcac
tggcgctggctgcagctggcagtctccctgcccaccttcctcttcctgctctactactgg
tgtgtgccggagtcccctcggtggctgttatcacaaaaaagaaacactgaagcaataaag
ataatggaccacatcgctcaaaagaatgggaagttgcctcctgctgatttaaagatgctt
tccctcgaagaggatgtcaccgaaaagctgagcccttcatttgcagacctgttccgcacg
ccgcgcctgaggaagcgcaccttcatcctgatgtacctgtggttcacggactctgtgctc
tatcaggggctcatcctgcacatgggcgccaccagcgggaacctctacctggatttcctt
tactccgctctggtcgaaatcccgggggccttcatagccctcatcaccattgaccgcgtg
ggccgcatctaccccatggccatgtcaaatttgttggcgggggcagcctgcctcgtcatg
atttttatctcacctgacctgcactggttaaacatcataatcatgtgtgttggccgaatg
ggaatcaccattgcaatacaaatgatctgcctggtgaatgctgagctgtaccccacattc
gtcaggaacctcggagtgatggtgtgttcctccctgtgtgacataggtgggataatcacc
cccttcatagtcttcaggctgagggaggtctggcaagccttgcccctcattttgtttgcg
gtgttgggcctgcttgccgcgggagtgacgctacttcttccagagaccaagggggtcgct
ttgccagagaccatgaaggacgccgagaaccttgggagaaaagcaaagcccaaagaaaac
acgatttaccttaaggtccaaacctcagaaccctcgggcacctga

DBGET integrated database retrieval system