KEGG   Homo sapiens (human): 6581Help
Entry
6581              CDS       T01001                                 

Gene name
SLC22A3, EMT, EMTH, OCT3
Definition
(RefSeq) solute carrier family 22 member 3
  KO
K08200  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    6581 (SLC22A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6581 (SLC22A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   6581 (SLC22A3)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    6581 (SLC22A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 6581
NCBI-ProteinID: NP_068812
OMIM: 604842
HGNC: 10967
Ensembl: ENSG00000146477
Vega: OTTHUMG00000015953
Pharos: O75751(Tchem)
UniProt: O75751
Position
6q25.3
AA seq 556 aa AA seqDB search
MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
CKCGRNKKTPVSRSHL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgccctccttcgacgaggcgctgcagcgggtgggcgagttcgggcgcttccagaggcgc
gtgtttttgctgctgtgcctgacgggcgtcaccttcgccttcctcttcgtcggcgtggtc
ttcctgggcacgcagcccgaccactactggtgccgcgggccaagtgccgcggcgctggcc
gagcgctgcggctggagcccggaggaggagtggaaccgcacggcgcccgcctcccgcggc
ccagagccccccgagcgccgcggccgctgccagcgctacctcctggaggcggccaacgac
agcgcctccgccactagcgctctcagctgcgcggacccactcgccgccttccccaaccgc
tcggctccccttgtgccgtgccgcggcggctggcgctacgcccaggcccactccaccatc
gtcagcgagtttgaccttgtctgtgtcaatgcgtggatgctggacctcacccaagccatc
ctgaacctcggcttcctgactggagcattcaccttaggctatgcagcagacaggtatggc
aggatcgtcatttacttgctatcctgccttggtgttggcgtcactggggttgtggtggcc
tttgcaccaaacttccctgtgtttgtgatcttccgcttcctgcaaggtgtatttggaaag
gggacgtggatgacttgctacgtgattgtgacagaaatagtaggttcgaaacaaaggagg
attgtgggaatcgtgattcaaatgttctttacccttggaatcataattctccctggaatt
gcctacttcatccccaactggcaaggaatccagttagccatcacgctgcccagctttctc
ttcctcctttattactgggtggtccctgagtctccccgttggctgattactcggaagaaa
ggagataaagcattacagatcctgagacgcattgctaagtgcaatgggaaatacctctca
tcaaattactcagagatcactgttacagatgaggaagttagtaatccatcctttttagat
ctggtgagaactccccaaatgaggaaatgcacacttattcttatgtttgcttggttcaca
agcgcagtggtgtatcaaggacttgtcatgcgcctgggaattatagggggcaacctctat
atagactttttcatctcgggcgtggtggaactgccaggagctctcttgatcttactaacc
attgagcgccttggacgacgcctcccctttgcggcaagcaatatagtggcaggggtggca
tgccttgtcactgcgttcttaccagaaggaatagcatggttgaggaccacagtggctaca
ttgggaagactagggataaccatggcctttgaaattgtttatttggtaaattcagaattg
tacccaacaacattacgaaatttcggagtttcgctctgttcaggtctgtgtgattttggg
ggaatcatagccccatttctgctctttcggctagcagccgtgtggctagaactacctctg
atcatctttggtatcctggcatccatctgtggtggccttgtgatgcttttgcctgaaacc
aagggtattgccttgccagagacagtggatgatgtagaaaaacttggcagtccacattcc
tgtaaatgtggcaggaataagaaaaccccagtttcccgctctcacctttga

DBGET integrated database retrieval system