KEGG   Homo sapiens (human): 6583Help
Entry
6583              CDS       T01001                                 

Gene name
SLC22A4, DFNB60, OCTN1
Definition
(RefSeq) solute carrier family 22 member 4
  KO
K08202  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 4/5
Organism
hsa  Homo sapiens (human)
Pathway
hsa05231  Choline metabolism in cancer
Disease
H00286  Crohn disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05231 Choline metabolism in cancer
    6583 (SLC22A4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6583 (SLC22A4)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   6583 (SLC22A4)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    6583 (SLC22A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 6583
NCBI-ProteinID: NP_003050
OMIM: 604190
HGNC: 10968
Ensembl: ENSG00000197208
Vega: OTTHUMG00000059648
Pharos: Q9H015(Tbio)
UniProt: Q9H015
Position
5q31.1
AA seq 551 aa AA seqDB search
MRDYDEVIAFLGEWGPFQRLIFFLLSASIIPNGFNGMSVVFLAGTPEHRCRVPDAANLSS
AWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFS
QDVYLSTVVTEWNLVCEDNWKVPLTTSLFFVGVLLGSFVSGQLSDRFGRKNVLFATMAVQ
TGFSFLQIFSISWEMFTVLFVIVGMGQISNYVVAFILGTEILGKSVRIIFSTLGVCTFFA
VGYMLLPLFAYFIRDWRMLLLALTVPGVLCVPLWWFIPESPRWLISQRRFREAEDIIQKA
AKMNNIAVPAVIFDSVEELNPLKQQKAFILDLFRTRNIAIMTIMSLLLWMLTSVGYFALS
LDAPNLHGDAYLNCFLSALIEIPAYITAWLLLRTLPRRYIIAAVLFWGGGVLLFIQLVPV
DYYFLSIGLVMLGKFGITSAFSMLYVFTAELYPTLVRNMAVGVTSTASRVGSIIAPYFVY
LGAYNRMLPYIVMGSLTVLIGILTLFFPESLGMTLPETLEQMQKVKWFRSGKKTRDSMET
EENPKVLITAF
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcgggactacgacgaggtgatcgccttcctgggcgagtgggggcccttccagcgcctc
atcttcttcctgctcagcgccagcatcatccccaatggcttcaatggtatgtcagtcgtg
ttcctggcggggaccccggagcaccgctgtcgagtgccggacgccgcgaacctgagcagc
gcctggcgcaacaacagtgtcccgctgcggctgcgggacggccgcgaggtgccccacagc
tgcagccgctaccggctcgccaccatcgccaacttctcggcgctcgggctggagccgggg
cgcgacgtggacctggggcagctggagcaggagagctgcctggatggctgggagttcagc
caggacgtctacctgtccaccgtcgtgaccgagtggaatctggtgtgtgaggacaactgg
aaggtgcccctcaccacctccctgttcttcgtaggcgtgctcctcggctccttcgtgtcc
gggcagctgtcagacaggtttggcaggaagaacgttctcttcgcaaccatggctgtacag
actggcttcagcttcctgcagattttctccatcagctgggagatgttcactgtgttattt
gtcatcgtgggcatgggccagatctccaactatgtggtagccttcatactaggaacagaa
attcttggcaagtcagttcgtattatattctctacattaggagtgtgcacattttttgca
gttggctatatgctgctgccactgtttgcttacttcatcagagactggcggatgctgctg
ctggcgctgacggtgccgggagtgctgtgtgtcccgctgtggtggttcattcctgaatct
ccccgatggctgatatcccagagaagatttagagaggctgaagatatcatccaaaaagct
gcaaaaatgaacaacatagctgtaccagcagtgatatttgattctgtggaggagctaaat
cccctgaagcagcagaaagctttcattctggacctgttcaggactcggaatattgccata
atgaccattatgtctttgctgctatggatgctgacctcagtgggttactttgctctgtct
ctggatgctcctaatttacatggagatgcctacctgaactgtttcctctctgccttgatt
gaaattccagcttacattacagcctggctgctattgcgaaccctgcccaggcgttatatc
atagctgcagtactgttctggggaggaggtgtgcttctcttcattcaactggtacctgtg
gattattacttcttatccattggtctggtcatgctgggaaaatttgggatcacctctgct
ttctccatgctgtatgtcttcactgctgagctctacccaaccctggtcaggaacatggcg
gtgggggtcacatccacggcctccagagtgggcagcatcattgccccctactttgtttac
ctcggtgcttacaacagaatgctgccctacatcgtcatgggtagtctgactgtcctgatt
ggaatcctcaccctttttttccctgaaagtttgggaatgactcttccagaaaccttagag
cagatgcagaaagtgaaatggttcagatctgggaaaaaaacaagagactcaatggagaca
gaagaaaatcccaaggttctaataactgcattctga

DBGET integrated database retrieval system