KEGG   Homo sapiens (human): 6588Help
Entry
6588              CDS       T01001                                 

Gene name
SLN
Definition
(RefSeq) sarcolipin
  KO
K22642  sarcolipin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6588 (SLN)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   6588 (SLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sarcolipin Phospholamban
Motif
Other DBs
NCBI-GeneID: 6588
NCBI-ProteinID: NP_003054
OMIM: 602203
HGNC: 11089
Ensembl: ENSG00000170290
Vega: OTTHUMG00000166364
Pharos: O00631(Tbio)
UniProt: O00631 A0A158RFT9
Position
11q22.3
AA seq 31 aa AA seqDB search
MGINTRELFLNFTIVLITVILMWLLVRSYQY
NT seq 96 nt NT seq  +upstreamnt  +downstreamnt
atggggataaacacccgggagctgtttctcaacttcactattgtcttgattacggttatt
cttatgtggctccttgtgaggtcctatcagtactga

DBGET integrated database retrieval system