KEGG   Homo sapiens (human): 659Help
Entry
659               CDS       T01001                                 

Gene name
BMPR2, BMPR-II, BMPR3, BMR2, BRK-3, POVD1, PPH1, T-ALK
Definition
(RefSeq) bone morphogenetic protein receptor type 2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05206  MicroRNAs in cancer
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00679  BMP signaling
Disease
H01619  Primary pulmonary hypertension
H01621  Pulmonary arterial hypertension
H01866  Pulmonary veno-occlusive disease and pulmonary capillary hemangiomatosis
Drug target
Dibotermin alfa: D03779
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    659 (BMPR2)
   04390 Hippo signaling pathway
    659 (BMPR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    659 (BMPR2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    659 (BMPR2)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    659 (BMPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    659 (BMPR2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    659 (BMPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    659 (BMPR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     659 (BMPR2)
Protein kinases [BR:hsa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   659 (BMPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp APH Cadherin_C_2 FTA2 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 659
NCBI-ProteinID: NP_001195
OMIM: 600799
HGNC: 1078
Ensembl: ENSG00000204217
Vega: OTTHUMG00000133617
Pharos: Q13873(Tchem)
UniProt: Q13873
Structure
PDB: 

Position
2q33.1-q33.2
AA seq 1038 aa AA seqDB search
MTSSLQRPWRVPWLPWTILLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHTTNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEATGQ
QDFTQTANGQACLIPDVLPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGTVLSGQTTNIVT
HRAQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDVLAQGVPSTAADPGPSKPRRAQRPNSLDLSATNVLDGSSIQIGEST
QDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSNRAVHSKSSTAVYLA
EGGTATTMVSKDIGMNCL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctcgctgcagcggccctggcgggtgccctggctaccatggaccatcctgctg
gtcagcactgcggctgcttcgcagaatcaagaacggctatgtgcgtttaaagatccgtat
cagcaagaccttgggataggtgagagtagaatctctcatgaaaatgggacaatattatgc
tcgaaaggtagcacctgctatggcctttgggagaaatcaaaaggggacataaatcttgta
aaacaaggatgttggtctcacattggagatccccaagagtgtcactatgaagaatgtgta
gtaactaccactcctccctcaattcagaatggaacataccgtttctgctgttgtagcaca
gatttatgtaatgtcaactttactgagaattttccacctcctgacacaacaccactcagt
ccacctcattcatttaaccgagatgagacaataatcattgctttggcatcagtctctgta
ttagctgttttgatagttgccttatgctttggatacagaatgttgacaggagaccgtaaa
caaggtcttcacagtatgaacatgatggaggcagcagcatccgaaccctctcttgatcta
gataatctgaaactgttggagctgattggccgaggtcgatatggagcagtatataaaggc
tccttggatgagcgtccagttgctgtaaaagtgttttcctttgcaaaccgtcagaatttt
atcaacgaaaagaacatttacagagtgcctttgatggaacatgacaacattgcccgcttt
atagttggagatgagagagtcactgcagatggacgcatggaatatttgcttgtgatggag
tactatcccaatggatctttatgcaagtatttaagtctccacacaagtgactgggtaagc
tcttgccgtcttgctcattctgttactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacctgcaatttcccatcgagatttaaacagcagaaatgtccta
gtgaaaaatgatggaacctgtgttattagtgactttggactgtccatgaggctgactgga
aatagactggtgcgcccaggggaggaagataatgcagccataagcgaggttggcactatc
agatatatggcaccagaagtgctagaaggagctgtgaacttgagggactgtgaatcagct
ttgaaacaagtagacatgtatgctcttggactaatctattgggagatatttatgagatgt
acagacctcttcccaggggaatccgtaccagagtaccagatggcttttcagacagaggtt
ggaaaccatcccacttttgaggatatgcaggttctcgtgtctagggaaaaacagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggagacaatc
gaagactgttgggaccaggatgcagaggctcggcttactgcacagtgtgctgaggaaagg
atggctgaacttatgatgatttgggaaagaaacaaatctgtgagcccaacagtcaatcca
atgtctactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatt
ggtccttatccagattattcttcctcctcatacattgaagactctatccatcatactgac
agcatcgtgaagaatatttcctctgagcattctatgtccagcacacctttgactataggg
gaaaaaaaccgaaattcaattaactatgaacgacagcaagcacaagctcgaatccccagc
cctgaaacaagtgtcaccagcctctccaccaacacaacaaccacaaacaccacaggactc
acgccaagtactggcatgactactatatctgagatgccatacccagatgaaacaaatctg
cataccacaaatgttgcacagtcaattgggccaacccctgtctgcttacagctgacagaa
gaagacttggaaaccaacaagctagacccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcactctcttaaacagttcagtggcccagacccactgagc
agtactagttctagcttgctttacccactcataaaacttgcagtagaagcaactggacag
caggacttcacacagactgcaaatggccaagcatgtttgattcctgatgttctgcctact
cagatctatcctctccccaagcagcagaaccttcccaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagagccccggctaaaatttggcagcaagcacaaatcaaac
ttgaaacaagtcgaaactggagttgccaagatgaatacaatcaatgcagcagaacctcat
gtggtgacagtcaccatgaatggtgtggcaggtagaaaccacagtgttaactcccatgct
gccacaacccaatatgccaatgggacagtactatctggccaaacaaccaacatagtgaca
catagggcccaagaaatgttgcagaatcagtttattggtgaggacacccggctgaatatt
aattccagtcctgatgagcatgagcctttactgagacgagagcaacaagctggccatgat
gaaggtgttctggatcgtcttgtggacaggagggaacggccactagaaggtggccgaact
aattccaataacaacaacagcaatccatgttcagaacaagatgttcttgcacagggtgtt
ccaagcacagcagcagatcctgggccatcaaagcccagaagagcacagaggcctaattct
ctggatctttcagccacaaatgtcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagaaacgtgtgaaaactccctattct
cttaagcggtggcgcccctccacctgggtcatctccactgaatcgctggactgtgaagtc
aacaataatggcagtaacagggcagttcattccaaatccagcactgctgtttaccttgca
gaaggaggcactgctacaaccatggtgtctaaagatataggaatgaactgtctgtga

DBGET integrated database retrieval system