KEGG   Homo sapiens (human): 6590Help
Entry
6590              CDS       T01001                                 

Gene name
SLPI, ALK1, ALP, BLPI, HUSI, HUSI-I, MPI, WAP4, WFDC4
Definition
(RefSeq) secretory leukocyte peptidase inhibitor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: WAP Conotoxin_I2 BES1_N
Motif
Other DBs
NCBI-GeneID: 6590
NCBI-ProteinID: NP_003055
OMIM: 107285
HGNC: 11092
Ensembl: ENSG00000124107
Vega: OTTHUMG00000033075
Pharos: P03973(Tbio)
UniProt: P03973
Structure
PDB: 

Position
20q13.12
AA seq 132 aa AA seqDB search
MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK
KRCCPDTCGIKCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMG
MCGKSCVSPVKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccagcggcctcttccccttcctggtgctgcttgccctgggaactctggcacct
tgggctgtggaaggctctggaaagtccttcaaagctggagtctgtcctcctaagaaatct
gcccagtgccttagatacaagaaacctgagtgccagagtgactggcagtgtccagggaag
aagagatgttgtcctgacacttgtggcatcaaatgcctggatcctgttgacaccccaaac
ccaacaaggaggaagcctgggaagtgcccagtgacttatggccaatgtttgatgcttaac
ccccccaatttctgtgagatggatggccagtgcaagcgtgacttgaagtgttgcatgggc
atgtgtgggaaatcctgcgtttcccctgtgaaagcttga

DBGET integrated database retrieval system