KEGG   Homo sapiens (human): 65977Help
Entry
65977             CDS       T01001                                 

Gene name
PLEKHA3, FAPP1
Definition
(RefSeq) pleckstrin homology domain containing A3
  KO
K20313  pleckstrin homology domain-containing family A member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    65977 (PLEKHA3)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   Others
    65977 (PLEKHA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_8 Muted PH_3 DUF5327
Motif
Other DBs
NCBI-GeneID: 65977
NCBI-ProteinID: NP_061964
OMIM: 607774
HGNC: 14338
Ensembl: ENSG00000116095
Vega: OTTHUMG00000154446
Pharos: Q9HB20(Tbio)
UniProt: Q9HB20
Structure
PDB: 

Position
2q31.2
AA seq 300 aa AA seqDB search
MEGVLYKWTNYLTGWQPRWFVLDNGILSYYDSQDDVCKGSKGSIKMAVCEIKVHSADNTR
MELIIPGEQHFYMKAVNAAERQRWLVALGSSKACLTDTRTKKEKEISETSESLKTKMSEL
RLYCDLLMQQVHTIQEFVHHDENHSSPSAENMNEASSLLSATCNTFITTLEECVKIANAK
FKPEMFQLHHPDPLVSPVSPSPVQMMKRSVSHPGSCSSERSSHSIKEPVSTLHRLSQRRR
RTYSDTDSCSDIPLEDPDRPVHCSKNTLNGDLASATIPEESRLMAKKQSESEDTLPSFSS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggagggggtgttgtacaagtggaccaactatctcacaggctggcagcctcgttggttt
gttttagataatggaatcttatcctactatgattcacaagatgatgtttgcaaagggagc
aaaggaagcataaagatggcagtttgtgaaattaaagttcattcagcagacaacacaaga
atggaattaatcattcctggagagcagcatttctacatgaaggcagtgaatgcagctgaa
agacagaggtggctggtcgctctggggagctccaaagcatgtttgactgatacaaggact
aaaaaagaaaaagaaataagtgaaaccagtgaatcgctgaaaaccaaaatgtctgaactt
cgcctctactgtgacctcttaatgcagcaagttcatacaatacaggaatttgttcaccat
gatgagaatcattcatctcctagtgcagagaacatgaatgaagcctcttctctgcttagt
gccacgtgtaacacattcatcacaacgcttgaggaatgtgtgaagatagccaatgccaag
tttaaacctgagatgtttcaactgcaccatccggatcccttagtttctcctgtgtcacct
tctcctgttcaaatgatgaagcgttctgtcagccaccctggttcttgcagttcagagagg
agtagccactctataaaagaaccagtatctacacttcaccgactctcccagcgacgccga
agaacctactcagatacagattcttgtagtgatattcctcttgaagacccagatagacct
gttcactgttcaaaaaatacacttaatggagatttggcatcagcaaccattcctgaagaa
agcagacttatggccaaaaaacaatctgaatcagaagatactcttccatccttctcttcc
tga

DBGET integrated database retrieval system