KEGG   Homo sapiens (human): 65980Help
Entry
65980             CDS       T01001                                 

Gene name
BRD9, LAVS3040, PRO9856
Definition
(RefSeq) bromodomain containing 9
  KO
K22184  bromodomain-containing protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    65980 (BRD9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    65980 (BRD9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3512 Bromodomain TFIIF_alpha NPR3 Zip
Motif
Other DBs
NCBI-GeneID: 65980
NCBI-ProteinID: NP_076413
OMIM: 618465
HGNC: 25818
Ensembl: ENSG00000028310
Vega: OTTHUMG00000159258
Pharos: Q9H8M2(Tchem)
UniProt: Q9H8M2
Structure
PDB: 

Position
5p15.33
AA seq 597 aa AA seqDB search
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaagcacaagaagcacaaggccgagtggcgctcgtcctacgaggattatgcc
gacaagcccctggagaagcctctaaagctagtcctgaaggtcggaggaagtgaagtgact
gaactctcaggatccggccacgactccagttactatgatgacaggtcagaccatgagcga
gagaggcacaaagaaaagaaaaagaagaagaagaagaagtccgagaaggagaagcatctg
gacgatgaggaaagaaggaagcgaaaggaagagaagaagcggaagcgagagagggagcac
tgtgacacggagggagaggctgacgactttgatcctgggaagaaggtggaggtggagccg
cccccagatcggccagtccgagcgtgccggacacagccagccgaaaatgagagcacacct
attcagcaactcctggaacacttcctccgccagcttcagagaaaagatccccatggattt
tttgcttttcctgtcacggatgcaattgctcctggatattcaatgataataaaacatccc
atggattttggcaccatgaaagacaaaattgtagctaatgaatacaagtcagttacggaa
tttaaggcagatttcaagctgatgtgtgataatgcaatgacatacaataggccagatacc
gtgtactacaagttggcgaagaagatccttcacgcaggctttaagatgatgagcaaacag
gcagctcttttgggcaatgaagatacagctgttgaggaacctgtccctgaagttgtacca
gtacaagtagaaactgccaagaaatccaaaaagccgagtagagaagttatcagctgcatg
tttgagcctgaagggaatgcctgcagcttgacggacagtaccgcagaggagcacgtgctg
gcgctggtggagcacgcagctgacgaagctcgggacaggatcaaccggttcctcccaggc
ggcaagatgggctatctgaagaggaacggggacgggagcctgctctacagcgtggtcaac
acggccgagccggacgctgatgaggaggagacccacccggtggacttgagctcgctctcc
agtaagctactcccaggcttcaccacgctgggcttcaaagacgagagaagaaacaaagtc
acctttctctccagtgccactactgcgctttcgatgcagaataattcagtatttggcgac
ttgaagtcggacgagatggagctgctctactcagcctacggagatgagacaggcgtgcag
tgtgcgctgagcctgcaggagtttgtgaaggatgctgggagctacagcaagaaagtggtg
gacgacctcctggaccagatcacaggcggagaccactctaggacgctcttccagctgaag
cagagaagaaatgttcccatgaagcctccagatgaagccaaggttggggacaccctagga
gacagcagcagctctgttctggagttcatgtcgatgaagtcctatcccgacgtttctgtg
gatatctccatgctcagctctctggggaaggtgaagaaggagctggaccctgacgacagc
catttgaacttggatgagacgacgaagctcctgcaggacctgcacgaagcacaggcggag
cgcggcggctctcggccgtcgtccaacctcagctccctgtccaacgcctccgagagggac
cagcaccacctgggaagcccttctcgcctgagtgtcggggagcagccagacgtcacccac
gacccctatgagtttcttcagtctccagagcctgcggcctctgccaagacctaa

DBGET integrated database retrieval system