KEGG   Homo sapiens (human): 6599Help
Entry
6599              CDS       T01001                                 

Gene name
SMARCC1, BAF155, CRACC1, Rsc8, SRG3, SWI3
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6599 (SMARCC1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    6599 (SMARCC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6599 (SMARCC1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6599 (SMARCC1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6599 (SMARCC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    6599 (SMARCC1)
   PBAF complex
    6599 (SMARCC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM-assoc_3 SWIRM SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 BRCT_2 DUF919 DUF2618
Motif
Other DBs
NCBI-GeneID: 6599
NCBI-ProteinID: NP_003065
OMIM: 601732
HGNC: 11104
Ensembl: ENSG00000173473
Vega: OTTHUMG00000133519
Pharos: Q92922(Tbio)
UniProt: Q92922 Q58EY4
Structure
PDB: 

Position
3p21.31
AA seq 1105 aa AA seqDB search
MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLG
KHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCH
ILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKL
ANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSY
DTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRI
STKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGKRRSQKE
EDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGG
KEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNK
SKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVD
PESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFG
LRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILH
FLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALE
EFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEK
MEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLV
ETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQ
QQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGP
GSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQ
QPPPPPPADGVPPPPAPGPPASAAP
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagcggcgggcggcggcgggccggggacagcggtaggcgccacgggctcgggg
attgcggcggcagccgcaggcctagctgtttatcgacggaaggatgggggcccggccacc
aagttttgggagagcccggagacggtgtcccagctggattcggtgcgggtctggctgggc
aagcactacaagaagtatgttcatgcggatgctcctaccaataaaacactggctgggctg
gtggtgcagcttcttcagttccaggaagatgcctttgggaagcatgtcaccaacccggcc
ttcaccaaactccctgcaaagtgtttcatggatttcaaagctggaggcgccttatgtcac
attcttggggctgcttacaagtataaaaatgaacagggatggcggaggtttgacctacag
aacccatctcgaatggatcgtaatgtggaaatgtttatgaacattgaaaaaacattggtg
cagaacaattgtttgaccagacccaacatctacctcattccagacattgatctgaagttg
gctaacaaattgaaagatatcatcaaacgacatcagggaacatttacggatgagaagtca
aaagcttcccaccacatttacccatattcttcctcacaagacgatgaagaatggttgaga
ccggtgatgagaaaagagaagcaagtgttagtgcattggggcttttacccagacagctat
gatacttgggtccatagtaatgatgttgatgctgaaattgaagatccaccaattccagaa
aaaccatggaaggttcatgtgaaatggattttggacactgatattttcaatgaatggatg
aatgaggaggattatgaggtggatgaaaataggaagcctgtgagttttcgtcagcggatt
tcaaccaagaatgaagagccagtcagaagtccagaaagaagagatagaaaagcatcagct
aatgctcgaaagaggaaacattcgccttcgcctccccctccgacaccaacagaatcacgg
aagaagagtgggaagaaaggccaagctagcctttatgggaagcgcagaagtcagaaagag
gaagatgagcaagaagatctaaccaaggatatggaagacccaacacctgtacccaatata
gaagaagtagtacttcccaaaaatgtgaacctaaagaaagatagtgaaaatacacctgtt
aaaggaggaactgtagcggatctagatgagcaggatgaagaaacagtcacagcaggagga
aaggaagatgaagatcctgccaaaggtgatcagagtcgatcagttgaccttggggaagat
aatgtgacagagcagaccaatcacattattattcctagttatgcatcatggtttgattat
aactgtattcatgtgattgaacggcgtgctcttcctgagttcttcaatggaaaaaacaaa
tccaagactccagaaatatacttggcatatcgaaattttatgattgacacgtatcgtcta
aacccccaagagtatttaactagcactgcttgtcggaggaacttgactggagatgtgtgt
gctgtgatgagggtccatgcctttttagagcagtggggactcgttaattaccaagttgac
ccggaaagtagacccatggcaatgggacctcctcctactcctcattttaatgtattagct
gataccccctctgggcttgtgcctctgcatcttcgatcacctcaggttcctgctgctcaa
cagatgctaaattttcctgagaaaaacaaggaaaaaccagttgatttgcagaactttggt
ctccgtactgacatttactccaagaaaacattagcaaagagtaaaggtgctagtgctgga
agagaatggactgaacaggagacccttctactcctggaggccctggagatgtacaaggat
gattggaacaaagtgtcggaacatgttggaagtcgtactcaggatgaatgcatcctccac
tttttgagacttcccattgaggacccataccttgagaattcagatgcttcccttgggcct
ttggcctaccagcctgtccccttcagtcagtcaggaaatccagttatgagtactgttgct
tttttggcatctgtggtggaccctcgcgtggcatctgctgcagcaaaagcggctttggag
gagttttctcgggtccgggaggaggtaccactggaattggttgaagctcatgtcaagaaa
gtacaagaagcagcacgagcctctgggaaagtggatcccacctacggtctggagagcagc
tgcattgcaggcacagggcccgatgagccagagaagcttgaaggagctgaagaggaaaaa
atggaagccgaccctgatggtcagcagcctgaaaaggcagaaaataaagtggaaaatgaa
acggatgaaggtgataaagcacaagatggagaaaatgaaaaaaatagtgaaaaggaacag
gatagtgaagtgagtgaggataccaaatcagaagaaaaggagactgaagagaacaaagaa
ctcactgatacatgtaaagaaagagaaagtgatactgggaagaagaaagtagaacatgaa
atttccgaaggaaatgttgccacagccgcagcagctgctcttgcctcagcggctaccaaa
gccaagcacctggctgcagtggaagaaagaaagatcaagtccctggtagctctcttggtt
gagacacaaatgaagaaactagagatcaaacttcgacattttgaagagctggaaactatc
atggacagagagaaagaagctctagaacaacagaggcagcagttgcttactgaacgccaa
aacttccacatggaacagctgaagtatgctgaattacgagcacgacagcaaatggaacag
cagcagcatggccagaaccctcaacaggcacaccagcactcaggaggacctggcctggcc
ccacttggagcagcagggcaccctggcatgatgcctcatcaacagccccctccctaccct
ctgatgcaccaccagatgccaccacctcatccaccccagccaggtcagataccaggccca
ggttccatgatgcccgggcagcacatgccaggccgcatgattcccactgttgcagccaac
atccacccctctgggagtggccctacccctcctggcatgccaccaatgccaggaaacatc
ttaggaccccgggtacccctgacagcacctaacggcatgtatccccctccaccacagcag
cagccaccgccaccaccacctgcagatggggtccctccgcctcctgctcctggcccgcca
gcctcagctgctccttag

KEGG   Homo sapiens (human): 6601Help
Entry
6601              CDS       T01001                                 

Gene name
SMARCC2, BAF170, CRACC2, CSS8, Rsc8
Definition
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Disease
H01403  Coffin-Siris syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6601 (SMARCC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    6601 (SMARCC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6601 (SMARCC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6601 (SMARCC2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6601 (SMARCC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    6601 (SMARCC2)
   PBAF complex
    6601 (SMARCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_2 SWIRM SWIRM-assoc_3 SWIRM-assoc_1 Myb_DNA-binding Myb_DNA-bind_6 Chromo BRCT_2
Motif
Other DBs
NCBI-GeneID: 6601
NCBI-ProteinID: NP_003066
OMIM: 601734
HGNC: 11105
Ensembl: ENSG00000139613
Vega: OTTHUMG00000170288
Pharos: Q8TAQ2(Tbio)
UniProt: Q8TAQ2 A0A024RB22
Position
12q13.2
AA seq 1214 aa AA seqDB search
MAVRKKDGGPNVKYYEAADTVTQFDNVRLWLGKNYKKYIQAEPPTNKSLSSLVVQLLQFQ
EEVFGKHVSNAPLTKLPIKCFLDFKAGGSLCHILAAAYKFKSDQGWRRYDFQNPSRMDRN
VEMFMTIEKSLVQNNCLSRPNIFLCPEIEPKLLGKLKDIIKRHQGTVTEDKNNASHVVYP
VPGNLEEEEWVRPVMKRDKQVLLHWGYYPDSYDTWIPASEIEASVEDAPTPEKPRKVHAK
WILDTDTFNEWMNEEDYEVNDDKNPVSRRKKISAKTLTDEVNSPDSDRRDKKGGNYKKRK
RSPSPSPTPEAKKKNAKKGPSTPYTKSKRGHREEEQEDLTKDMDEPSPVPNVEEVTLPKT
VNTKKDSESAPVKGGTMTDLDEQEDESMETTGKDEDENSTGNKGEQTKNPDLHEDNVTEQ
THHIIIPSYAAWFDYNSVHAIERRALPEFFNGKNKSKTPEIYLAYRNFMIDTYRLNPQEY
LTSTACRRNLAGDVCAIMRVHAFLEQWGLINYQVDAESRPTPMGPPPTSHFHVLADTPSG
LVPLQPKTPQQTSASQQMLNFPDKGKEKPTDMQNFGLRTDMYTKKNVPSKSKAAASATRE
WTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPIEDPYLEDSEASLGPLA
YQPIPFSQSGNPVMSTVAFLASVVDPRVASAAAKSALEEFSKMKEEVPTALVEAHVRKVE
EAAKVTGKADPAFGLESSGIAGTTSDEPERIEESGNDEARVEGQATDEKKEPKEPREGGG
AIEEEAKEKTSEAPKKDEEKGKEGDSEKESEKSDGDPIVDPEKEKEPKEGQEEVLKEVVE
SEGERKTKVERDIGEGNLSTAAAAALAAAAVKAKHLAAVEERKIKSLVALLVETQMKKLE
IKLRHFEELETIMDREREALEYQRQQLLADRQAFHMEQLKYAEMRARQQHFQQMHQQQQQ
PPPALPPGSQPIPPTGAAGPPAVHGLAVAPASVVPAPAGSGAPPGSLGPSEQIGQAGSTA
GPQQQQPAGAPQPGAVPPGVPPPGPHGPSPFPNQQTPPSMMPGAVPGSGHPGVAGNAPLG
LPFGMPPPPPPPAPSIIPFGSLADSISINLPAPPNLHGHHHHLPFAPGTLPPPNLPVSMA
NPLHPNLPATTTMPSSLPLGPGLGSAAAQSPAIVAAVQGNLLPSASPLPDPGTPLPPDPT
APSPGTVTPVPPPQ
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcggaagaaggacggcggccccaacgtgaagtactacgaggccgcggacacc
gtgacccagttcgacaacgtgcggctgtggctcggcaagaactacaagaagtatatacaa
gctgaaccacccaccaacaagtccctgtctagcctggttgtacagttgctacaatttcag
gaagaagtttttggcaaacatgtcagcaatgcaccgctcactaaactgccgatcaaatgt
ttcctagatttcaaagcgggaggctccttgtgccacattcttgcagctgcctacaaattc
aagagtgaccagggatggcggcgttacgatttccagaatccatcacgcatggaccgcaat
gtggaaatgtttatgaccattgagaagtccttggtgcagaataattgcctgtctcgacct
aacatttttctgtgcccagaaattgagcccaaactactagggaaattaaaggacattatc
aagagacaccagggaacagtcactgaggataagaacaatgcctcccatgttgtgtatcct
gtcccggggaatctagaagaagaggaatgggtacgaccagtcatgaagagggataagcag
gttcttctgcactggggctactatcctgacagttacgacacgtggatcccagcgagtgaa
attgaggcatctgtggaagatgctccaactcctgagaaacctaggaaggttcatgcaaag
tggatcctggacaccgacaccttcaatgaatggatgaatgaggaagactatgaagtaaat
gatgacaaaaaccctgtctcccgccgaaagaagatttcagccaagacactgacagatgag
gtgaacagcccagattcagatcgacgggacaagaaggggggaaactataagaagaggaag
cgctccccctctccttcaccaaccccagaagcaaagaagaaaaatgctaagaaaggtccc
tcaacaccttacactaagtcaaagcgtggccacagagaagaggagcaagaagacctgaca
aaggacatggacgagccctcaccagtccccaatgtagaagaggtgacacttcccaaaaca
gtcaacacaaagaaagactcagagtcggccccagtcaaaggcggcaccatgaccgacctg
gatgaacaggaagatgaaagcatggagacgacgggcaaggatgaggatgagaacagtacg
gggaacaagggagagcagaccaagaatccagacctgcatgaggacaatgtgactgaacag
acccaccacatcatcattcccagctacgctgcctggtttgactacaatagtgttcatgcc
attgagcggagggctctccccgagttcttcaacggcaagaacaagtccaagactccagag
atctacctggcctatcgaaactttatgattgacacttaccgactgaacccccaagagtat
cttacctctaccgcctgccgccgaaacctagcgggtgatgtctgtgccatcatgagggtc
catgccttcctagaacagtggggtcttattaactaccaggtggatgctgagagtcgacca
accccaatggggcctccgcctacctctcacttccatgtcttggctgacacaccatcaggg
ctggtgcctctgcagcccaagacacctcagcagacctctgcttcccaacaaatgctcaac
tttcctgacaaaggcaaagagaaaccaacagacatgcaaaactttgggctgcgcacagac
atgtacacaaaaaagaatgttccctccaagagcaaggctgcagccagtgccactcgtgag
tggacagaacaggaaaccctgcttctcctggaggcactggaaatgtacaaagatgactgg
aacaaagtgtccgagcatgtgggaagccgcacacaggacgagtgcatcttgcattttctt
cgtcttcccattgaagacccatacctggaggactcagaggcctccctaggccccctggcc
taccaacccatccccttcagtcagtcgggcaaccctgttatgagcactgttgccttcctg
gcctctgtcgtcgatccccgagtcgcctctgctgctgcaaagtcagccctagaggagttc
tccaaaatgaaggaagaggtacccacggccttggtggaggcccatgttcgaaaagtggaa
gaagcagccaaagtaacaggcaaggcggaccctgccttcggtctggaaagcagtggcatt
gcaggaaccacctctgatgagcctgagcggattgaggagagcgggaatgacgaggctcgg
gtggaaggccaggccacagatgagaagaaggagcccaaggaaccccgagaaggagggggt
gctatagaggaggaagcaaaagagaaaaccagcgaggctcccaagaaggatgaggagaaa
gggaaagaaggcgacagtgagaaggagtccgagaagagtgatggagacccaatagtcgat
cctgagaaggagaaggagccaaaggaagggcaggaggaagtgctgaaggaagtggtggag
tctgagggggaaaggaagacaaaggtggagcgggacattggcgagggcaacctctccacc
gctgctgccgccgccctggccgccgccgcagtgaaagctaagcacttggctgctgttgag
gaaaggaagatcaaatctttggtggccctgctggtggagacccagatgaaaaagttggag
atcaaacttcggcactttgaggagctggagactatcatggaccgggagcgagaagcactg
gagtatcagaggcagcagctcctggccgacagacaagccttccacatggagcagctgaag
tatgcggagatgagggctcggcagcagcacttccaacagatgcaccaacagcagcagcag
ccaccaccagccctgcccccaggctcccagcctatccccccaacaggggctgctgggcca
cccgcagtccatggcttggctgtggctccagcctctgtagtccctgctcctgctggcagt
ggggcccctccaggaagtttgggcccttctgaacagattgggcaggcagggtcaactgca
gggccacagcagcagcaaccagctggagccccccagcctggggcagtcccaccaggggtt
cccccccctggaccccatggcccctcaccgttccccaaccaacaaactcctccctcaatg
atgccaggggcagtgccaggcagcgggcacccaggcgtggcgggtaatgctcctttgggt
ttgccttttggcatgccgcctcctcctcctcctcctgctccatccatcatcccatttggt
agtctagctgactccatcagtattaacctccccgctcctcctaacctgcatgggcatcac
caccatctcccgttcgccccgggcactctccccccacctaacctgcctgtgtccatggcg
aaccctctacatcctaacctgccggcgaccaccaccatgccatcttccttgcctctcggg
ccggggctcggatccgccgcagcccaaagccctgccattgtggcagctgttcagggcaac
ctcctgcccagtgccagcccactgccagacccaggcacccccctgcctccagaccccaca
gccccgagcccaggcacggtcacccctgtgccacctccacagtga

DBGET integrated database retrieval system