KEGG   Homo sapiens (human): 660Help
Entry
660               CDS       T01001                                 

Gene name
BMX, ETK, PSCTK2, PSCTK3
Definition
(RefSeq) BMX non-receptor tyrosine kinase
  KO
K08896  cytoplasmic tyrosine-protein kinase BMX [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    660 (BMX)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     660 (BMX)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  TEC family
   660 (BMX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 PH BTK Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 660
NCBI-ProteinID: NP_001712
OMIM: 300101
HGNC: 1079
Ensembl: ENSG00000102010
Vega: OTTHUMG00000021180
Pharos: P51813(Tchem)
UniProt: P51813
Structure
PDB: 

Position
Xp22.2
AA seq 675 aa AA seqDB search
MDTKSILEELLLKRSQQKKKMSPNNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIEIKKI
RCVEKVNLEEQTPVERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHLLVKY
HSGFFVDGKFLCCQQSCKAAPGCTLWEAYANLHTAVNEEKHRVPTFPDRVLKIPRAVPVL
KMDAPSSSTTLAQYDNESKKNYGSQPPSSSTSLAQYDSNSKKIYGSQPNFNMQYIPREDF
PDWWQVRKLKSSSSSEDVASSNQKERNVNHTTSKISWEFPESSSSEEEENLDDYDWFAGN
ISRSQSEQLLRQKGKEGAFMVRNSSQVGMYTVSLFSKAVNDKKGTVKHYHVHTNAENKLY
LAENYCFDSIPKLIHYHQHNSAGMITRLRHPVSTKANKVPDSVSLGNGIWELKREEITLL
KELGSGQFGVVQLGKWKGQYDVAVKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCS
KEYPIYIVTEYISNGCLLNYLRSHGKGLEPSQLLEMCYDVCEGMAFLESHQFIHRDLAAR
NCLVDRDLCVKVSDFGMTRYVLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGI
LMWEVFSLGKQPYDLYDNSQVVLKVSQGHRLYRPHLASDTIYQIMYSCWHELPEKRPTFQ
QLLSSIEPLREKDKH
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaaatctattctagaagaacttcttctcaaaagatcacagcaaaagaagaaa
atgtcaccaaataattacaaagaacggctttttgttttgaccaaaacaaacctttcctac
tatgaatatgacaaaatgaaaaggggcagcagaaaaggatccattgaaattaagaaaatc
agatgtgtggagaaagtaaatctcgaggagcagacgcctgtagagagacagtacccattt
cagattgtctataaagatgggcttctctatgtctatgcatcaaatgaagagagccgaagt
cagtggttgaaagcattacaaaaagagataaggggtaacccccacctgctggtcaagtac
catagtgggttcttcgtggacgggaagttcctgtgttgccagcagagctgtaaagcagcc
ccaggatgtaccctctgggaagcatatgctaatctgcatactgcagtcaatgaagagaaa
cacagagttcccaccttcccagacagagtgctgaagatacctcgggcagttcctgttctc
aaaatggatgcaccatcttcaagtaccactctagcccaatatgacaacgaatcaaagaaa
aactatggctcccagccaccatcttcaagtaccagtctagcgcaatatgacagcaactca
aagaaaatctatggctcccagccaaacttcaacatgcagtatattccaagggaagacttc
cctgactggtggcaagtaagaaaactgaaaagtagcagcagcagtgaagatgttgcaagc
agtaaccaaaaagaaagaaatgtgaatcacaccacctcaaagatttcatgggaattccct
gagtcaagttcatctgaagaagaggaaaacctggatgattatgactggtttgctggtaac
atctccagatcacaatctgaacagttactcagacaaaagggaaaagaaggagcatttatg
gttagaaattcgagccaagtgggaatgtacacagtgtccttatttagtaaggctgtgaat
gataaaaaaggaactgtcaaacattaccacgtgcatacaaatgctgagaacaaattatac
ctggcagaaaactactgttttgattccattccaaagcttattcattatcatcaacacaat
tcagcaggcatgatcacacggctccgccaccctgtgtcaacaaaggccaacaaggtcccc
gactctgtgtccctgggaaatggaatctgggaactgaaaagagaagagattaccttgttg
aaggagctgggaagtggccagtttggagtggtccagctgggcaagtggaaggggcagtat
gatgttgctgttaagatgatcaaggagggctccatgtcagaagatgaattctttcaggag
gcccagactatgatgaaactcagccatcccaagctggttaaattctatggagtgtgttca
aaggaataccccatatacatagtgactgaatatataagcaatggctgcttgctgaattac
ctgaggagtcacggaaaaggacttgaaccttcccagctcttagaaatgtgctacgatgtc
tgtgaaggcatggccttcttggagagtcaccaattcatacaccgggacttggctgctcgt
aactgcttggtggacagagatctctgtgtgaaagtatctgactttggaatgacaaggtat
gttcttgatgaccagtatgtcagttcagtcggaacaaagtttccagtcaagtggtcagct
ccagaggtgtttcattacttcaaatacagcagcaagtcagacgtatgggcatttgggatc
ctgatgtgggaggtgttcagcctggggaagcagccctatgacttgtatgacaactcccag
gtggttctgaaggtctcccagggccacaggctttaccggccccacctggcatcggacacc
atctaccagatcatgtacagctgctggcacgagcttccagaaaagcgtcccacatttcag
caactcctgtcttccattgaaccacttcgggaaaaagacaagcattga

DBGET integrated database retrieval system