KEGG   Homo sapiens (human): 66008Help
Entry
66008             CDS       T01001                                 

Gene name
TRAK2, ALS2CR3, CALS-C, GRIF-1, GRIF1, MILT2, OIP98
Definition
(RefSeq) trafficking kinesin protein 2
  KO
K15374  trafficking kinesin-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
hsa04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    66008 (TRAK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAP1_N Milton CCDC144C
Motif
Other DBs
NCBI-GeneID: 66008
NCBI-ProteinID: NP_055864
OMIM: 607334
HGNC: 13206
Ensembl: ENSG00000115993
Vega: OTTHUMG00000132822
Pharos: O60296(Tbio)
UniProt: O60296
Position
2q33.1
AA seq 914 aa AA seqDB search
MSQSQNAIFTSPTGEENLMNSNHRDSESITDVCSNEDLPEVELVSLLEEQLPQYRLKVDT
LFLYENQDWTQSPHQRQHASDALSPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNESLEEQLGQAFDQVNQLQHELCKKDELLRIVSI
ASEESETDSSCSTPLRFNESFSLSQGLLQLEMLQEKLKELEEENMALRSKACHIKTETVT
YEEKEQQLVSDCVKELRETNAQMSRMTEELSGKSDELIRYQEELSSLLSQIVDLQHKLKE
HVIEKEELKLHLQASKDAQRQLTMELHELQDRNMECLGMLHESQEEIKELRSRSGPTAHL
YFSQSYGAFTGESLAAEIEGTMRKKLSLDEESSLFKQKAQQKRVFDTVRIANDTRGRSIS
FPALLPIPGSNRSSVIMTAKPFESGLQQTEDKSLLNQGSSSEEVAGSSQKMGQPGPSGDS
DLATALHRLSLRRQNYLSEKQFFAEEWQRKIQVLADQKEGVSGCVTPTESLASLCTTQSE
ITDLSSASCLRGFMPEKLQIVKPLEGSQTLYHWQQLAQPNLGTILDPRPGVITKGFTQLP
GDAIYHISDLEEDEEEGITFQVQQPLEVEEKLSTSKPVTGIFLPPITSAGGPVTVATANP
GKCLSCTNSTFTFTTCRILHPSDITQVTPSSGFPSLSCGSSGSSSSNTAVNSPALSYRLS
IGESITNRRDSTTTFSSTMSLAKLLQERGISAKVYHSPISENPLQPLPKSLAIPSTPPNS
PSHSPCPSPLPFEPRVHLSENFLASRPAETFLQEMYGLRPSRNPPDVGQLKMNLVDRLKR
LGIARVVKNPGAQENGRCQEAEIGPQKPDSAVYLNSGSSLLGGLRRNQSLPVIMGSFAAP
VCTSSPKMGVLKED
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatcccagaatgcaatttttacatcaccaacaggtgaagaaaacctcatgaat
agcaatcacagagactcggagagcatcactgatgtctgctccaatgaggatctccctgaa
gttgagctggtgagtctgctagaagaacaactaccacagtataggctaaaagtagacact
ctctttctatatgaaaatcaagactggactcagtctccacaccagcggcagcatgcatct
gatgctctctctccagtccttgctgaagagactttccgttacatgattctaggcacagac
agggtggagcagatgaccaaaacttacaatgacatcgacatggttacacatctcctggca
gagagggatcgtgatctggaactcgctgctcgaattggacaagctctcttaaagcggaac
catgtcttatctgagcagaacgaatccctggaggagcaattgggacaagcctttgatcaa
gttaatcagctgcagcatgagctatgcaagaaagatgagttacttcgaatcgtctccatt
gcttctgaagaaagtgaaactgattccagctgttctacacctcttcggttcaatgagtcc
tttagcttatctcaagggttgctgcagttggaaatgctgcaagaaaagctcaaggaactg
gaagaagagaatatggctcttcgatccaaggcttgtcacataaagacagaaactgttacc
tatgaagaaaaggaacaacagcttgtcagcgactgtgttaaagaacttcgtgaaacaaat
gctcagatgtccagaatgactgaagaattgtcagggaagagtgatgagctgattcgatac
caagaagagctttcctctcttttgtcacagattgtagaccttcagcacaaacttaaagaa
catgtgattgagaaggaagaactaaaacttcacctgcaagcttccaaagatgcccaacgg
caactgacaatggagctgcacgagttacaagacaggaatatggagtgtctaggaatgtta
catgaatcccaagaagaaataaaggaacttcgtagtagatctggccctactgctcatctc
tacttctcccaatcatatggagcttttactggggaatctttggcagctgagattgagggg
actatgcgtaaaaagctgagtttggatgaggaatcttctctctttaaacaaaaagcccaa
cagaagcgggtatttgataccgtcaggattgccaatgacacacggggccgctctatctca
ttcccagctctgttacccattccaggctccaaccgttcaagtgtcatcatgacagcaaaa
ccttttgagtctggtcttcagcaaacagaggacaaatcactcctgaaccaggggagcagc
tcagaggaggttgcagggagctcccagaagatgggccaaccaggaccctcaggagatagt
gatttggctacagcactgcatcgccttagcttgcgtcgacaaaactatttaagtgagaag
cagttctttgctgaagaatggcagcggaagatccaggttctggcagaccagaaggaagga
gttagtggctgtgtcaccccgacagagagccttgcctctctctgcaccacccagtcagag
atcacagacctcagcagtgccagttgccttcgaggttttatgccagaaaaattacaaatt
gtcaagccccttgaaggatcacaaactctgtatcactggcagcagcttgctcaaccaaac
ttgggaaccatccttgatccacgaccaggtgtcattactaaaggctttacccagttgccc
ggggatgctatttatcacatctcagatttagaagaggatgaagaggagggtattactttt
caggttcagcaacctcttgaagtggaagagaaactttcaacatccaagccagtaacaggg
atcttcctgccacccattacttcagcaggtggaccagttacagttgcaaccgccaaccca
ggaaagtgcctgtcgtgcacaaactcaacattcactttcaccacctgtagaatattacat
ccctctgacatcactcaggttacccccagctctgggttcccttcattatcctgtggaagt
agcggtagcagttcatccaacacggctgtgaattctcctgccttgtcctatagactcagc
attggtgagtccatcaccaaccgacgagattccactacaaccttcagtagcaccatgagc
ttggccaaacttctacaagagcgaggcatctctgccaaagtgtaccacagcccaatttca
gagaaccccctccagcctctccctaaatccctggctatcccttccacaccaccaaattca
ccatctcactcaccttgcccttctcctttaccctttgagcctcgagtgcatctctctgaa
aattttttggcctctcgaccagctgagacattcctccaggagatgtatggcttgagaccc
tcccggaaccctcctgatgttggccagttgaagatgaacttagtggacaggctgaagaga
ctggggatagccagagtggtcaagaaccctggtgcccaagagaatggaagatgccaggag
gcagaaattggtcctcaaaaaccagattctgctgtttatttaaattcaggtagcagttta
ttaggtggactaaggaggaatcagagtcttccagtcataatgggtagctttgctgcccca
gtttgcacatcctcacccaaaatgggtgtcctgaaggaggactga

DBGET integrated database retrieval system