KEGG   Homo sapiens (human): 66036Help
Entry
66036             CDS       T01001                                 

Gene name
MTMR9, C8orf9, LIP-STYX, MTMR8
Definition
(RefSeq) myotubularin related protein 9
  KO
K18084  myotubularin-related protein 9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    66036 (MTMR9)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    66036 (MTMR9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related UPF0449
Motif
Other DBs
NCBI-GeneID: 66036
NCBI-ProteinID: NP_056273
OMIM: 606260
HGNC: 14596
Ensembl: ENSG00000104643
Vega: OTTHUMG00000090647
Pharos: Q96QG7(Tbio)
UniProt: Q96QG7
Position
8p23.1
AA seq 549 aa AA seqDB search
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQTRAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNTKQKWEAPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNQPSELSKFTNPLFEANNL
VIWPSVAPQSLPLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKVNILRRQLAELE
TEDGMQESP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgcggagctgattaagaccccgcgggtggacaatgtggtgctgcaccggcct
ttctacccggctgtcgagggcaccctgtgcctgacgggccaccacttgatcctgtcctcc
cggcaggacaatacggaggagctgtggctcctccattcaaacatcgacgccatcgacaag
cgatttgtaggatcactgggtaccatcatcataaaatgtaaagattttcgaattattcag
ttggatattcctggaatggaggaatgcttgaatatagccagttccattgaggcattgtct
actctggactccatcactctgatgtaccctttcttttaccgtcctatgtttgaagtgata
gaagatggctggcattccttccttcctgagcaagaatttgaactctattcttcagctacc
agtgaatggaggctaagctatgtcaataaggaatttgctgtctgtccctcttacccacca
attgtcacagtgcccaaatccatcgatgatgaagctcttcggaaggtagctacatttcga
catggagggcgcttcccagtactaagctattaccacaaaaaaaatgggatggtaattatg
cgaagtggtcagccactcactggtacaaacgggaggaggtgcaaggaggacgagaagctg
ataaatgctaccctcagggctggaaagcgtggctacatcattgacacccgatccctgaac
gtggctcagcaaactagagccaaaggaggtggctttgaacaagaagctcattatcctcag
tggaggcgaattcataagtccattgagaggtatcacattcttcaggagagcttaatcaaa
cttgtggaagcttgtaatgaccaaacacataacatggaccgatggctcagtaaattggag
gcctctaactggctgactcacatcaaagagattctgacaactgcctgcctagcggctcag
tgcatcgacagggaaggagcatcaatattgattcacggaacagaaggaactgattccaca
ctccaggtgacctccttggcccagatcatcttagagccaagaagcaggaccattcgtggt
tttgaggccctgattgaaagagagtggctgcaggctggtcacccattccagcagcgctgt
gcacagtcagcctactgtaacaccaagcagaagtgggaggctcctgtatttcttctcttc
ttggactgcgtgtggcagatccttcgtcagtttccctgttcttttgagtttaatgagaat
ttcctcatcatgctctttgagcatgcttatgcctcacagtttggaacatttctgggcaac
aatgaaagtgaaagatgtaagttgaagctacagcagaagacgatgtctttgtggtcctgg
gttaatcagcccagtgagctgagtaaattcaccaatcccctctttgaagccaacaacctt
gtcatctggccttcagttgctccgcagagtcttccactgtgggaaggtattttcctacgt
tggaatagatcctctaagtatttggatgaagcatatgaagaaatggttaacatcattgaa
tataataaagaattacaagcaaaagtcaatatccttcgaaggcagttggcagaactggaa
acagaggacgggatgcaggagagtccctga

DBGET integrated database retrieval system