KEGG   Homo sapiens (human): 6611Help
Entry
6611              CDS       T01001                                 

Gene name
SMS, MRSR, SPMSY, SRS, SpS
Definition
(RefSeq) spermine synthase
  KO
K00802  spermine synthase [EC:2.5.1.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00330  Arginine and proline metabolism
hsa00410  beta-Alanine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
Disease
H00597  Snyder-Robinson syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    6611 (SMS)
   00330 Arginine and proline metabolism
    6611 (SMS)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    6611 (SMS)
   00480 Glutathione metabolism
    6611 (SMS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.22  spermine synthase
     6611 (SMS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spermine_synth SpmSyn_N Spermine_synt_N DUF43 Citrate_bind
Motif
Other DBs
NCBI-GeneID: 6611
NCBI-ProteinID: NP_004586
OMIM: 300105
HGNC: 11123
Ensembl: ENSG00000102172
Vega: OTTHUMG00000021239
Pharos: P52788(Tchem)
UniProt: P52788
Structure
PDB: 

Position
Xp22.11
AA seq 366 aa AA seqDB search
MAAARHSTLDFMLGAKADGETILKGLQSIFQEQGMAESVHTWQDHGYLATYTNKNGSFAN
LRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAI
DRYWPTADGRLVEYDIDEVVYDEDSPYQNIKILHSKQFGNILILSGDVNLAESDLAYTRA
IMGSGKEDYTGKDVLILGGGDGGILCEIVKLKPKMVTMVEIDQMVIDGCKKYMRKTCGDV
LDNLKGDCYQVLIEDCIPVLKRYAKEGREFDYVINDLTAVPISTSPEEDSTWEFLRLILD
LSMKVLKQDGKYFTQGNCVNLTEALSLYEEQLGRLYCPVEFSKEIVCVPSYLELWVFYTV
WKKAKP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagcacggcacagcacgctcgacttcatgctcggcgccaaagctgatggtgag
accattctaaaaggcctccagtccattttccaggagcaggggatggcggagtcggtgcac
acctggcaggaccatggctatttagcaacctacacaaacaagaacggcagctttgccaat
ttgagaatttacccacatggattggtgttgctggaccttcagagttatgatggtgatgcg
caaggcaaagaagagatcgacagtattttgaacaaagtagaggaaagaatgaaagaattg
agtcaggacagtactgggcgggtgaaacgattaccacccatagtgcgaggaggagccatc
gacagatactggcccaccgccgacgggcgcctggttgaatatgacatagatgaagtggta
tatgacgaagattcaccttatcaaaatataaaaattctacactcgaagcagtttggaaat
attctcatccttagtggggatgttaatttggcagagagtgatttggcatatacccgggcc
atcatgggcagtggcaaagaagattacactggcaaagatgtactcattctgggaggtgga
gacggaggcatattgtgtgaaatagtcaaactaaaaccaaagatggtcactatggtagag
attgaccaaatggtgattgatgggtgtaagaaatacatgcgaaaaacgtgtggcgatgtc
ttagacaatcttaaaggagactgctatcaggttctaatagaagactgtatcccggtactg
aagaggtacgccaaagaagggagagaatttgattatgtgattaatgatttgacagctgtt
ccaatctccacgtctccagaagaagattccacatgggagtttctcagactgattcttgac
ctctcaatgaaagtgttgaaacaggatgggaaatattttacacaggggaactgtgtcaat
ctgacagaagcactgtcgctctatgaagaacagctggggcgcctgtattgtcctgtggaa
ttttcaaaggagatcgtctgtgtcccttcatacttggaattgtgggtattttacactgtt
tggaagaaagctaaaccctga

DBGET integrated database retrieval system