KEGG   Homo sapiens (human): 6613Help
Entry
6613              CDS       T01001                                 

Gene name
SUMO2, HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A
Definition
(RefSeq) small ubiquitin like modifier 2
  KO
K12160  small ubiquitin-related modifier
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6613 (SUMO2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6613 (SUMO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6613 (SUMO2)
   04121 Ubiquitin system [BR:hsa04121]
    6613 (SUMO2)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    6613 (SUMO2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    6613 (SUMO2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     6613 (SUMO2)
Ubiquitin system [BR:hsa04121]
 Ubiquitins and Ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   6613 (SUMO2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    6613 (SUMO2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    6613 (SUMO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 6613
NCBI-ProteinID: NP_008868
OMIM: 603042
HGNC: 11125
Ensembl: ENSG00000188612
Vega: OTTHUMG00000179481
Pharos: P61956(Tbio)
UniProt: P61956 A0A024R8S3
Structure
PDB: 

Position
17q25.1
AA seq 95 aa AA seqDB search
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRF
RFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaaaagcccaaggaaggagtcaagactgagaacaacgatcatattaatttg
aaggtggcggggcaggatggttctgtggtgcagtttaagattaagaggcatacaccactt
agtaaactaatgaaagcctattgtgaacgacagggattgtcaatgaggcagatcagattc
cgatttgacgggcaaccaatcaatgaaacagacacacctgcacagttggaaatggaggat
gaagatacaattgatgtgttccaacagcagacgggaggtgtctactga

DBGET integrated database retrieval system