KEGG   Homo sapiens (human): 6616Help
Entry
6616              CDS       T01001                                 

Gene name
SNAP25, CMS18, RIC-4, RIC4, SEC9, SNAP, SNAP-25, SUP, bA416N4.2, dJ1068F16.2
Definition
(RefSeq) synaptosome associated protein 25
  KO
K18211  synaptosomal-associated protein 25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04721  Synaptic vesicle cycle
hsa04911  Insulin secretion
Disease
H00770  Congenital myasthenic syndrome
Drug target
Botulinum toxin (DG00772): D00783 D02735
Incobotulinumtoxin A: D10012
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    6616 (SNAP25)
  Nervous system
   04721 Synaptic vesicle cycle
    6616 (SNAP25)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    6616 (SNAP25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP-25 DUF5089 Use1 Exonuc_VII_L Sec20 V-SNARE_C DUF349 XhlA
Motif
Other DBs
NCBI-GeneID: 6616
NCBI-ProteinID: NP_001309831
OMIM: 600322
HGNC: 11132
Ensembl: ENSG00000132639
Vega: OTTHUMG00000031863
Pharos: P60880(Tbio)
UniProt: P60880
Structure
PDB: 

Position
20p12.2
AA seq 206 aa AA seqDB search
MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRV
EEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARV
VDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDR
IMEKADSNKTRIDEANQRATKMLGSG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagacgcagacatgcgcaatgagctggaggagatgcagcgaagggctgaccag
ttggctgatgagtcgctggaaagcacccgtcgtatgctgcaactggttgaagagagtaaa
gatgctggtatcaggactttggttatgttggatgaacaaggagaacaactcgatcgtgtc
gaagaaggcatgaaccatatcaaccaagacatgaaggaggctgagaaaaatttaaaagat
ttagggaaatgctgtggccttttcatatgtccttgtaacaagcttaaatcaagtgatgct
tacaaaaaagcctggggcaataatcaggacggagtggtggccagccagcctgctcgtgta
gtggacgaacgggagcagatggccatcagtggcggcttcatccgcagggtaacaaatgat
gcccgagaaaatgaaatggatgaaaacctagagcaggtgagcggcatcatcgggaacctc
cgtcacatggccctggatatgggcaatgagatcgatacacagaatcgccagatcgacagg
atcatggagaaggctgattccaacaaaaccagaattgatgaggccaaccaacgtgcaaca
aagatgctgggaagtggttaa

DBGET integrated database retrieval system