KEGG   Homo sapiens (human): 662
Entry
662               CDS       T01001                                 

Gene name
BNIP1, NIP1, SEC20, TRG-8
Definition
(RefSeq) BCL2 interacting protein 1
  KO
K08497  protein transport protein SEC20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    662 (BNIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    662 (BNIP1)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Sec20
    662 (BNIP1)
SSDB
Motif
Pfam: Sec20 TAF4 DUF5097 DUF2777 DUF2856 Phage_GP20
Other DBs
NCBI-GeneID: 662
NCBI-ProteinID: NP_001196
OMIM: 603291
HGNC: 1082
Ensembl: ENSG00000113734
Vega: OTTHUMG00000130521
Pharos: Q12981(Tbio)
UniProt: Q12981
Position
5q35.1
AA seq 228 aa
MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQD
LEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDL
LRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSM
SGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
NT seq 687 nt   +upstreamnt  +downstreamnt
atggcggctccccaagacgtccacgtccggatctgtaaccaagagattgtcaaatttgac
ctggaggtgaaggcgcttattcaggatatccgtgattgttcaggacccttaagtgctctt
actgaactgaatactaaagtaaaagagaaatttcaacagttgcgtcacagaatacaggac
ctggagcagttggctaaagagcaagacaaagaatcagagaaacaacttctactccaggaa
gtggagaatcacaaaaagcagatgctcagcaatcaggcctcatggaggaaagctaatctc
acctgcaaaattgcaatcgacaatctagagaaagcagaacttcttcagggaggagatctc
ttaaggcaaaggaaaaccaccaaagagagcctggcccagacatccagtaccatcactgag
agcctcatggggatcagcaggatgatggcccagcaggtccagcagagcgaggaggccatg
cagtctctagtcacttcttcacgaacgatcctggatgcaaatgaagaatttaagtccatg
tcgggcaccatccagctgggccggaagcttatcacaaaatacaatcgccgggagctgacg
gacaagcttctcatcttccttgcgctagccctgtttcttgctacggtcctctatattgtg
aaaaagcggctctttccatttttgtga

DBGET integrated database retrieval system