KEGG   Homo sapiens (human): 6621Help
Entry
6621              CDS       T01001                                 

Gene name
SNAPC4, PTFalpha, SNAP190
Definition
(RefSeq) small nuclear RNA activating complex polypeptide 4
  KO
K09453  snRNA-activating protein complex subunit 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6621 (SNAPC4)
   03021 Transcription machinery [BR:hsa03021]
    6621 (SNAPC4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-like factors
    6621 (SNAPC4)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Other transcription-related factors
    snRNA-activating protein complex (SNAPc)
     6621 (SNAPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 SLIDE HTH_23
Motif
Other DBs
NCBI-GeneID: 6621
NCBI-ProteinID: NP_003077
OMIM: 602777
HGNC: 11137
Ensembl: ENSG00000165684
Vega: OTTHUMG00000020929
Pharos: Q5SXM2(Tbio)
UniProt: Q5SXM2 A0A024R8F4
Position
9q34.3
AA seq 1469 aa AA seqDB search
MDVDAEREKITQEIKELERILDPGSSGSHVEISESSLESDSEADSLPSEDLDPADPPISE
EERWGEASNDEDDPKDKTLPEDPETCLQLNMVYQEVIQEKLAEANLLLAQNREQQEELMR
DLAGSKGTKVKDGKSLPPSTYMGHFMKPYFKDKVTGVGPPANEDTREKAAQGIKAFEELL
VTKWKNWEKALLRKSVVSDRLQRLLQPKLLKLEYLHQKQSKVSSELERQALEKQGREAEK
EIQDINQLPEEALLGNRLDSHDWEKISNINFEGSRSAEEIRKFWQNSEHPSINKQEWSRE
EEERLQAIAAAHGHLEWQKIAEELGTSRSAFQCLQKFQQHNKALKRKEWTEEEDRMLTQL
VQEMRVGSHIPYRRIVYYMEGRDSMQLIYRWTKSLDPGLKKGYWAPEEDAKLLQAVAKYG
EQDWFKIREEVPGRSDAQCRDRYLRRLHFSLKKGRWNLKEEEQLIELIEKYGVGHWAKIA
SELPHRSGSQCLSKWKIMMGKKQGLRRRRRRARHSVRWSSTSSSGSSSGSSGGSSSSSSS
SSEEDEPEQAQAGEGDRALLSPQYMVPDMDLWVPARQSTSQPWRGGAGAWLGGPAASLSP
PKGSSASQGGSKEASTTAAAPGEETSPVQVPARAHGPVPRSAQASHSADTRPAGAEKQAL
EGGRRLLTVPVETVLRVLRANTAARSCTQKEQLRQPPLPTSSPGVSSGDSVARSHVQWLR
HRATQSGQRRWRHALHRRLLNRRLLLAVTPWVGDVVVPCTQASQRPAVVQTQADGLREQL
QQARLASTPVFTLFTQLFHIDTAGCLEVVRERKALPPRLPQAGARDPPVHLLQASSSAQS
TPGHLFPNVPAQEASKSASHKGSRRLASSRVERTLPQASLLASTGPRPKPKTVSELLQEK
RLQEARAREATRGPVVLPSQLLVSSSVILQPPLPHTPHGRPAPGPTVLNVPLSGPGAPAA
AKPGTSGSWQEAGTSAKDKRLSTMQALPLAPVFSEAEGTAPAASQAPALGPGQISVSCPE
SGLGQSQAPAASRKQGLPEAPPFLPAAPSPTPLPVQPLSLTHIGGPHVATSVPLPVTWVL
TAQGLLPVPVPAVVSLPRPAGTPGPAGLLATLLPPLTETRAAQGPRAPALSSSWQPPANM
NREPEPSCRTDTPAPPTHALSQSPAEADGSVAFVPGEAQVAREIPEPRTSSHADPPEAEP
PWSGRLPAFGGVIPATEPRGTPGSPSGTQEPRGPLGLEKLPLRQPGPEKGALDLEKPPLP
QPGPEKGALDLGLLSQEGEAATQQWLGGQRGVRVPLLGSRLPYQPPALCSLRALSGLLLH
KKALEHKATSLVVGGEAERPAGALQASLGLVRGQLQDNPAYLLLRARFLAAFTLPALLAT
LAPQGVRTTLSVPSRVGSESEDEDLLSELELADRDGQPGCTTATCPIQGAPDSGKCSASS
CLDTSNDPDDLDVLRTRHARHTRKRRRLV
NT seq 4410 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagatgctgaaagagagaagataacacaggagatcaaggagctggaaaggatt
ttggatcccggctcctcgggctcccacgtggagatctcagaatcaagtctcgagtcagat
tctgaagcagattcactgccttctgaggacttggatcctgccgatcccccgatctcggaa
gaagaaaggtggggcgaagccagcaatgacgaggacgatcccaaggataaaaccctccct
gaagacccagaaacctgcctgcagctgaacatggtctaccaggaggtcatccaggagaag
ctggctgaggccaacctgctgctggcccagaaccgggagcagcaggaggaactcatgagg
gatctggctgggtccaaaggcaccaaggtgaaagatggcaaaagcctgcccccaagcaca
tacatggggcacttcatgaagccgtatttcaaggacaaggtcacgggcgtggggccacct
gccaacgaggacacacgagagaaggctgcccaggggatcaaggctttcgaggagctcctt
gtgaccaaatggaaaaactgggaaaaggccttgctccgaaagtcagtggtgagtgaccgc
ctgcagcgattgcttcagcccaagttactgaagctcgagtacttgcaccagaagcagagc
aaagtctccagtgagctggagaggcaagccctggagaagcagggcagggaagccgagaag
gagatccaggacatcaaccagcttccagaagaggccttgctgggaaacaggctggacagc
cacgactgggagaagatttccaatattaactttgaaggcagccgcagtgcagaggagatc
cggaagttctggcagaactcggagcaccccagcatcaacaagcaggagtggagcagggag
gaggaggagcggctgcaggcgatcgcggctgcacacggccacctggagtggcagaagatt
gcagaggagctggggaccagccgcagcgccttccagtgcctgcagaaattccagcagcac
aacaaagctctgaaacgcaaggagtggacagaggaggaggaccgcatgctcacgcagctg
gtgcaggagatgcgcgtcggcagccacatcccctaccgcagaattgtctactatatggaa
gggagagactccatgcagctgatctaccgatggaccaagagcttggatcctggtctgaag
aagggttactgggccccggaggaagatgctaagttgcttcaagctgttgccaaatacggg
gagcaggattggtttaaaatccgggaagaggtgccaggtaggagcgatgcccagtgccga
gatcggtatctcaggagattacatttcagcttgaaaaagggtcggtggaatttaaaagaa
gaggaacagttaattgaattaatagaaaaatatggtgtcggtcactgggcaaaaatagct
tctgagctgccccatcggtctggctcccagtgtctgagcaagtggaagatcatgatgggg
aagaagcagggtctccggaggcggcggcggagggcccgtcacagcgtccggtggagctct
accagcagcagcggcagcagcagtggcagcagtggagggagcagcagcagcagcagcagc
agcagcgaggaggacgagccagagcaggcgcaggccggggagggtgacagagcgctgctg
tccccacagtacatggtcccggacatggacctgtgggttcctgccaggcagagcaccagc
cagccatggagaggaggggcaggggcctggctgggaggccccgctgcctccctcagccct
cccaaggggtccagtgccagccagggcggcagcaaggaagcttccaccacagccgcggct
cctggagaggagacgagtccggtgcaggtccctgccagggcccacggccctgtcccgagg
tctgcccaggcctcccactcagcagacactcgcccggcgggcgcagagaagcaggccctg
gagggtgggaggcgtctgctgacagtgcctgtggagaccgtgctgagggtgctcagggcc
aacacggctgctcggagctgcacacagaaagagcagctgaggcagccacccctgcccacc
tcatccccaggggtcagctctggtgacagcgtggcccgatcccatgtgcagtggctacgg
cacagagccacccagagtgggcagcggcgctggagacacgctctgcaccggaggctcctg
aaccgcaggctgctgctggctgtgaccccttgggtaggggacgttgtcgtgccctgcaca
caggcttcccagagacccgccgtagtgcagactcaagcggatggcctcagggagcagctg
cagcaggcccgcctggccagcacccctgtgtttaccctgtttacccagctgttccacatc
gatactgccggctgcttggaggtcgtccgagagaggaaggccctgccacccaggctgccc
caggctggtgctcgggacccaccagttcatcttctgcaggcatcctcaagtgcccagagc
accccaggccacctcttcccaaacgtgccggctcaagaagcctcaaagagtgccagccac
aaagggagccgaagactggcgtccagccgggtggagcgcaccctaccccaggcgtccctg
ctggcttcaaccggcccccggcccaagcccaagactgtgtcggagctgcttcaggagaag
cggcttcaggaggcccgtgccagggaggccacccggggcccggtggtgctcccgtcccag
ctgctggtctcctcgtctgtgatcctccagccccctctaccacacaccccacacggccgc
ccagccccgggtcccaccgtcttaaatgtaccgctctctgggcctggggcccccgcggca
gccaaacctggcacttctggctcctggcaggaggctgggacttcagccaaggacaagaga
ctctccaccatgcaagccctgcccctcgctcctgtcttctcagaggccgagggcacagcc
cctgctgcttcccaagcccctgccctgggccccggccagatctctgtgagctgccccgag
agtggtctcggacagtctcaggcccccgctgcatcccggaagcagggcctgcctgaggcg
ccaccctttctccccgcagcccccagccccaccccactgcccgtccagcccctcagcctg
acgcacataggagggccacatgtggcgaccagtgtccccctgcctgtcacctgggtgctc
acagcccaggggcttctccctgttcctgtaccagctgtggtgagccttcccaggccagca
gggacccctggccccgcagggctgctggccactctgctgcctcccctgactgagactcgg
gcggcccagggccccagggccccagcgttgagcagctcttggcagcccccagccaatatg
aacagggaaccggagccttcctgcaggacagacaccccagctcctcccacacacgccctc
tcccaaagtcctgcagaagcggatggcagtgtggcctttgtccctggagaggcccaggtg
gccagggagatacctgagcccaggacgtcctcccacgctgaccctcctgaagcagaaccc
ccttggtccgggaggctgccagccttcggtggtgtcatcccagcaactgagccaaggggg
acgccggggtccccctcagggacacaggagcccagggggcctctgggcctggagaagctg
cccctgcgccagcctgggcctgagaagggggccctggacctggagaagccgcccctaccc
cagcctgggcctgagaagggggccctggacctgggcctgctgtcccaggagggcgaggcg
gccacacagcagtggctggggggccagcggggggtgcgtgtgcctcttctgggcagcaga
ctgccctatcagcccccagccctgtgcagcctgcgagctctgtccggtctcctactccac
aagaaggccctggagcacaaggccacctccctggtggtggggggcgaggctgagcggccg
gccggagcactgcaagcctcactggggctggtgcgggggcagctccaggacaacccggcc
tacctcctgttgcgggcgcggttcctggcagccttcaccctccctgcgctcctggccacc
ctggccccccaaggcgtccgcaccaccctctcagtaccttcgagggtgggctctgagagt
gaggatgaagacctcctgagtgagctggaacttgcagacagggacgggcagccgggctgc
acgacagccacatgccccattcagggagccccagactctggtaaatgctctgcttcctcc
tgcctggatacttctaatgaccctgacgacctggacgtgctcagaacccggcatgccagg
cacacccggaagcggaggcggctggtgtga

DBGET integrated database retrieval system