KEGG   Homo sapiens (human): 6622
Entry
6622              CDS       T01001                                 

Gene name
SNCA, NACP, PARK1, PARK4, PD1
Definition
(RefSeq) synuclein alpha
  KO
K04528  alpha-synuclein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Network
nt06410  Calcium signaling
nt06412  Unfolded protein response (UPR) signaling
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06420  Ubiquitin-proteasome system
nt06422  Dopamine metabolism
nt06463  Parkinson disease
  Element
N01019  Parkin-mediated ubiquitination
N01020  Mutation-inactivated PRKN to Parkin-mediated ubiquitination
N01030  Mutation-caused aberrant SNCA to 26S proteasome-mediated protein degradation
N01031  Mutation-caused aberrant SNCA to VGCC-Ca2+ -apoptotic pathway
N01033  Mutation-caused aberrant SNCA to ATF6-mediated transcription
N01034  Mutation-caused aberrant SNCA to IRE1a-XBP1 signaling pathway
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01037  Mutation-caused aberrant SNCA to L-DOPA generation
N01041  Mutation-caused aberrant SNCA to transport of dopamine
N01042  Mutation-caused aberrant SNCA to electron transfer in Complex I
N01055  Mutation-caused aberrant SNCA to anterograde axonal transport
Disease
H00057  Parkinson disease
H00066  Lewy body dementia (LBD)
H01600  Parkinsonian syndrome
Drug target
Cinpanemab: D11467
Prasinezumab: D11420
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6622 (SNCA)
   05012 Parkinson disease
    6622 (SNCA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6622 (SNCA)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    6622 (SNCA)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    6622 (SNCA)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   6622 (SNCA)
SSDB
Motif
Pfam: Synuclein
Other DBs
NCBI-GeneID: 6622
NCBI-ProteinID: NP_000336
OMIM: 163890
HGNC: 11138
Ensembl: ENSG00000145335
Vega: OTTHUMG00000130948
Pharos: P37840(Tchem)
UniProt: P37840
Structure
PDB: 

Position
4q22.1
AA seq 140 aa
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
NT seq 423 nt   +upstreamnt  +downstreamnt
atggatgtattcatgaaaggactttcaaaggccaaggagggagttgtggctgctgctgag
aaaaccaaacagggtgtggcagaagcagcaggaaagacaaaagagggtgttctctatgta
ggctccaaaaccaaggagggagtggtgcatggtgtggcaacagtggctgagaagaccaaa
gagcaagtgacaaatgttggaggagcagtggtgacgggtgtgacagcagtagcccagaag
acagtggagggagcagggagcattgcagcagccactggctttgtcaaaaaggaccagttg
ggcaagaatgaagaaggagccccacaggaaggaattctggaagatatgcctgtggatcct
gacaatgaggcttatgaaatgccttctgaggaagggtatcaagactacgaacctgaagcc
taa

DBGET integrated database retrieval system