KEGG   Homo sapiens (human): 6622Help
Entry
6622              CDS       T01001                                 

Gene name
SNCA, NACP, PARK1, PARK4, PD1
Definition
(RefSeq) synuclein alpha
  KO
K04528  alpha-synuclein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
Disease
H00057  Parkinson disease (PD)
H00066  Lewy body dementia (LBD)
H01600  Parkinsonian syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    6622 (SNCA)
   05012 Parkinson disease
    6622 (SNCA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6622 (SNCA)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    6622 (SNCA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Synuclein
Motif
Other DBs
NCBI-GeneID: 6622
NCBI-ProteinID: NP_000336
OMIM: 163890
HGNC: 11138
Ensembl: ENSG00000145335
Vega: OTTHUMG00000130948
Pharos: P37840(Tchem)
UniProt: P37840
Structure
PDB: 

Position
4q22.1
AA seq 140 aa AA seqDB search
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
DNEAYEMPSEEGYQDYEPEA
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggatgtattcatgaaaggactttcaaaggccaaggagggagttgtggctgctgctgag
aaaaccaaacagggtgtggcagaagcagcaggaaagacaaaagagggtgttctctatgta
ggctccaaaaccaaggagggagtggtgcatggtgtggcaacagtggctgagaagaccaaa
gagcaagtgacaaatgttggaggagcagtggtgacgggtgtgacagcagtagcccagaag
acagtggagggagcagggagcattgcagcagccactggctttgtcaaaaaggaccagttg
ggcaagaatgaagaaggagccccacaggaaggaattctggaagatatgcctgtggatcct
gacaatgaggcttatgaaatgccttctgaggaagggtatcaagactacgaacctgaagcc
taa

DBGET integrated database retrieval system