KEGG   Homo sapiens (human): 6625Help
Entry
6625              CDS       T01001                                 

Gene name
SNRNP70, RNPU1Z, RPU1, SNRP70, Snp1, U1-70K, U170K, U1AP, U1RNP
Definition
(RefSeq) small nuclear ribonucleoprotein U1 subunit 70
  KO
K11093  U1 small nuclear ribonucleoprotein 70kDa
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00351  Spliceosome, U1-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6625 (SNRNP70)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6625 (SNRNP70)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    6625 (SNRNP70)
 Complex B
    6625 (SNRNP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: U1snRNP70_N RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 6625
NCBI-ProteinID: NP_003080
OMIM: 180740
HGNC: 11150
Ensembl: ENSG00000104852
Vega: OTTHUMG00000183344
Pharos: P08621(Tbio)
UniProt: P08621 A0A024QZD5
Structure
PDB: 

Position
19q13.33
AA seq 437 aa AA seqDB search
MTQFLPPNLLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRA
ETREERMERKRREKIERRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLR
REFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVER
GRTVKGWRPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSPLPHRDRDRDRERE
RRERSRERDKERERRRSRSRDRRRRSRSRDKEERRRSRERSKDKDRDRKRRSSRSRERAR
RERERKEELRGGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEKGRDRDRERRRSHRS
ERERRRDRDRDRDRDREHKRGERGSERGRDEARGGGGGQDNGLEGLGNDSRDMYMESEGG
DGYLAPENGYLMEAAPE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgacccagttcctgccgcccaaccttctggccctctttgccccccgtgaccctattcca
tacctgccacccctggagaaactgccacatgaaaaacaccacaatcaaccttattgtggc
attgcgccgtacattcgagagtttgaggaccctcgagatgcccctcctccaactcgtgct
gaaacccgagaggagcgcatggagaggaaaagacgggaaaagattgagcggcgacagcaa
gaagtggagacagagcttaaaatgtgggaccctcacaatgatcccaatgctcagggggat
gccttcaagactctcttcgtggcgagagtgaattatgacacaacagaatccaagctccgg
agagagtttgaggtgtacggacctatcaaaagaatacacatggtctacagtaagcggtca
ggaaagccccgtggctatgccttcatcgagtacgaacacgagcgagacatgcactccgct
tacaaacacgcagatggcaagaagattgatggcaggagggtccttgtggacgtggagagg
ggccgaaccgtgaagggctggaggccccggcggctaggaggaggcctcggtggtaccaga
agaggaggggctgatgtgaacatccggcattcaggccgcgatgacacctcccgctacgat
gagaggcccggcccctccccgcttccgcacagggaccgggaccgggaccgtgagcgggag
cgcagagagcggagccgggagcgagacaaggagcgagaacggcgacgctcccgctcccgg
gaccggcggaggcgctcacggagtcgcgacaaggaggagcggaggcgctccagggagcgg
agcaaggacaaggaccgggaccggaagcggcgaagcagccggagtcgggagcgggcccgg
cgggagcgggagcgcaaggaggagctgcgtggcggcggtggcgacatggcggagccctcc
gaggcgggtgacgcgccccctgatgatgggcctccaggggagctcgggcctgacggccct
gacggtccagaggaaaagggccgggatcgtgaccgggagcgacggcggagccaccggagc
gagcgcgagcggcgccgggaccgggatcgtgaccgtgaccgtgaccgcgagcacaaacgg
ggggagcggggcagtgagcggggcagggatgaggcccgaggtgggggcggtggccaggac
aacgggctggagggtctgggcaacgacagccgagacatgtacatggagtctgagggcggc
gacggctacctggctccggagaatgggtatttgatggaggctgcgccggagtga

DBGET integrated database retrieval system