KEGG   Homo sapiens (human): 6627Help
Entry
6627              CDS       T01001                                 

Gene name
SNRPA1, Lea1, U2A'
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide A'
  KO
K11092  U2 small nuclear ribonucleoprotein A'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00352  Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6627 (SNRPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6627 (SNRPA1)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    6627 (SNRPA1)
 Complex B
    6627 (SNRPA1)
 Complex C
   U2 SnRNP specific factors
    6627 (SNRPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_9 LRR_4 LRR_8
Motif
Other DBs
NCBI-GeneID: 6627
NCBI-ProteinID: NP_003081
OMIM: 603521
HGNC: 11152
Ensembl: ENSG00000131876
Vega: OTTHUMG00000149871
Pharos: P09661(Tbio)
UniProt: P09661
Structure
PDB: 

Position
15q26.3
AA seq 255 aa AA seqDB search
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGF
PLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSI
LRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKT
FNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTD
DGEEEMEEDTVTNGS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagctgacggcggagctgatcgagcaggcggcgcagtacaccaacgcggtgcgc
gaccgggagctggacctccgggggtataaaattcccgtcattgaaaatctaggtgctacg
ttagaccagtttgatgctattgatttttctgacaatgagatcaggaaactggatggtttt
cctttgttgagaagactgaaaacattgttagtgaacaacaacagaatatgccgtataggt
gagggacttgatcaggctctgccctgtctgacagaactcattctcaccaataatagtctc
gtggaactgggtgatctggaccctctggcatctctcaaatcgctgacttacctaagtatc
ctaagaaatccggtaaccaataagaagcattacagattgtatgtgatttataaagttccg
caagtcagagtactggatttccagaaagtgaaactaaaagagcgtcaggaagcagagaaa
atgttcaagggcaaacggggtgcacagcttgcaaaggatattgccaggagaagcaaaact
tttaatccaggtgctggtttgccaactgacaaaaagaaaggtgggccatctccaggggat
gtagaagcaatcaagaatgccatagcaaatgcttcaactctggctgaagtggagaggctg
aaggggttgctgcagtctggtcagatccctggcagagaacgcagatcagggcccactgat
gatggtgaagaagagatggaagaagacacagtcacaaacgggtcctga

DBGET integrated database retrieval system