KEGG   Homo sapiens (human): 6628
Entry
6628              CDS       T01001                                 

Gene name
SNRPB, CCMS, COD, SNRPB1, Sm-B/B', SmB/B', SmB/SmB', snRNP-B
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptides B and B1
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05322  Systemic lupus erythematosus
Disease
H01843  Cerebrocostomandibular syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6628 (SNRPB)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6628 (SNRPB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6628 (SNRPB)
   03032 DNA replication proteins [BR:hsa03032]
    6628 (SNRPB)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6628 (SNRPB)
  U2 snRNP components
    6628 (SNRPB)
 Complex B
  U1 snRNP components
    6628 (SNRPB)
  U4/U6.U5 tri-snRNP components
    6628 (SNRPB)
 Complex C
  U2 snRNP components
    6628 (SNRPB)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6628 (SNRPB)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 6628
NCBI-ProteinID: NP_937859
OMIM: 182282
HGNC: 11153
Ensembl: ENSG00000125835
Vega: OTTHUMG00000031694
Pharos: P14678(Tbio)
UniProt: P14678
Structure
PDB: 

Position
20p13
AA seq 240 aa
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacggtgggcaagagcagcaagatgctgcagcatattgattacaggatgaggtgcatc
ctgcaggacggccggatcttcattggcaccttcaaggcttttgacaagcacatgaatttg
atcctctgtgactgtgatgagttcagaaagatcaagccaaagaactccaaacaagcagaa
agggaagagaagcgagtcctcggtctggtgctgctgcgaggggagaatctggtctcaatg
acagtagagggacctcctcccaaagatactggtattgctcgagttccacttgctggagct
gccgggggcccagggatcggcagggctgctggcagaggaatcccagctggggttcccatg
ccccaggctcctgcaggacttgctgggccagtccgtggggttggcgggccatcccaacag
gtgatgaccccacaaggaagaggtactgttgcagccgctgcagctgctgccacagccagt
attgccggggctccaacccagtacccacctggccgtgggggtcctcccccacctatgggc
cgaggagcaccccctccaggcatgatgggcccacctcctggtatgagacctcctatgggt
cccccaatggggatcccccctggaagagggactccaatgggcatgccccctccgggaatg
cggcctcctccccctgggatgcgagggccccctcccccgggaatgcgcccaccaaggccc
tag

DBGET integrated database retrieval system