KEGG   Homo sapiens (human): 6629Help
Entry
6629              CDS       T01001                                 

Gene name
SNRPB2, Msl1, U2B''
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide B2
  KO
K11094  U2 small nuclear ribonucleoprotein B''
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00352  Spliceosome, U2-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6629 (SNRPB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6629 (SNRPB2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    6629 (SNRPB2)
 Complex B
    6629 (SNRPB2)
 Complex C
   U2 SnRNP specific factors
    6629 (SNRPB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_5 RRM_occluded DUF1027
Motif
Other DBs
NCBI-GeneID: 6629
NCBI-ProteinID: NP_003083
OMIM: 603520
HGNC: 11155
Ensembl: ENSG00000125870
Vega: OTTHUMG00000031933
Pharos: P08579(Tbio)
UniProt: P08579
Structure
PDB: 

Position
20p12.1
AA seq 225 aa AA seqDB search
MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELG
SSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTT
NKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEV
RLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggatatcagaccaaatcatacaatttatatcaacaatatgaatgacaaaattaaaaag
gaagaattgaagagatccctatatgccctgttttctcagtttggtcatgtggtggacatt
gtggctttaaagaccatgaagatgagggggcaggcctttgtcatatttaaggaactgggc
tcatccacaaatgccttgagacagctacaaggatttccattttatggtaaaccaatgcga
atacagtatgcaaaaacagattcggatataatatcaaaaatgcgtggaacttttgctgac
aaagaaaagaaaaaagaaaagaaaaaagccaaaactgtggaacagactgcaacaaccaca
aacaaaaagcctggccagggaactccaaattcagctaatacccaaggaaattcaacacca
aatcctcaggtccctgattaccctccaaactatattttattccttaataacttaccagaa
gagactaatgagatgatgttatccatgctgtttaatcagttccctggcttcaaggaagta
cgtctggtaccagggaggcatgacattgcttttgttgaatttgaaaatgatgggcaggct
ggagctgccagggatgctttacagggatttaagatcacaccgtcccatgctatgaagatc
acctatgccaagaaataa

DBGET integrated database retrieval system