KEGG   Homo sapiens (human): 663Help
Entry
663               CDS       T01001                                 

Gene name
BNIP2, BNIP-2, NIP2
Definition
(RefSeq) BCL2 interacting protein 2
  KO
K18448  BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    663 (BNIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNIP2 CRAL_TRIO_2 CRAL_TRIO
Motif
Other DBs
NCBI-GeneID: 663
NCBI-ProteinID: NP_004321
OMIM: 603292
HGNC: 1083
Ensembl: ENSG00000140299
Vega: OTTHUMG00000132727
Pharos: Q12982(Tbio)
UniProt: Q12982 J3KN59
Position
15q22.2
AA seq 314 aa AA seqDB search
MEGVELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISL
TLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTA
AEEKEDGRRWRMFRIGEQDHRVDMKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQ
PNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKN
LKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVD
QELNGKQDEPKNEQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtgtggaacttaaagaagaatggcaagatgaagattttccgatacctttacca
gaagatgatagtattgaagcagatatactagctataactggaccagaggaccagcctggc
tcactagaagttaatggaaataaagtgagaaagaaactaatggctccagacattagcctg
acactggatcctagtgatggctctgtattgtcagatgatttggatgaaagtggggagatt
gacttagatggcttagacacaccgtcagagaatagtaatgagtttgagtgggaagatgat
cttccaaaacccaagactactgaagtaattaggaaaggctcaattactgaatacacagca
gcagaggaaaaagaagatggacgacgctggcgtatgttcaggattggagaacaggaccac
agggttgatatgaaggcaattgaaccctataaaaaagttatcagccatgggggatattat
ggggatggattaaatgccattgttgtgtttgctgtctgtttcatgcctgaaagtagtcag
cctaactatagatacctgatggacaatctttttaaatatgttattggcactttggagcta
ttagtagcagaaaactacatgatagtttatttaaatggtgcaacaactcgaagaaaaatg
cccagtctgggatggctcaggaaatgttatcagcaaattgatagaaggttacggaaaaat
ctaaaatccctaatcattgtacatccttcttggtttatcagaacacttctggctgttaca
agaccatttattagctcgaaattcagccaaaaaattagatacgtgtttaatttggcagaa
ctagcagaacttgtccccatggaatacgttggcataccagaatgcataaaacaagttgat
caagaacttaatggaaaacaagatgaaccgaaaaatgaacagtaa

DBGET integrated database retrieval system