KEGG   Homo sapiens (human): 6631Help
Entry
6631              CDS       T01001                                 

Gene name
SNRPC, U1C, Yhc1
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide C
  KO
K11095  U1 small nuclear ribonucleoprotein C
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Module
hsa_M00351  Spliceosome, U1-snRNP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6631 (SNRPC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6631 (SNRPC)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    6631 (SNRPC)
 Complex B
    6631 (SNRPC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-U1
Motif
Other DBs
NCBI-GeneID: 6631
NCBI-ProteinID: NP_003084
OMIM: 603522
HGNC: 11157
Ensembl: ENSG00000124562
Vega: OTTHUMG00000014555
Pharos: P09234(Tbio)
UniProt: P09234 Q5TAL4
Structure
PDB: 

Position
6p21.31
AA seq 159 aa AA seqDB search
MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQG
KIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAP
GMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagttttattgtgactactgcgatacatacctcacccatgactctccatctgtg
agaaagacacactgcagtggaaggaaacacaaagagaatgtgaaagactattatcagaaa
tggatggaagagcaggctcagagcctgattgacaaaacaacggctgcatttcaacaagga
aagatacctcctactccattctctgctcctcctcctgcaggggcgatgataccacctccc
cccagccttccgggtcctcctcgccctggtatgatgccagcaccccatatggggggccct
cccatgatgccaatgatgggccctcctcctcctgggatgatgccagtgggacctgctcct
ggaatgaggccgcccatgggaggccatatgccaatgatgcctgggcccccaatgatgaga
cctcctgcccgtcccatgatggtgcccactcggcccggaatgactcgaccagacagataa

DBGET integrated database retrieval system