KEGG   Homo sapiens (human): 6632Help
Entry
6632              CDS       T01001                                 

Gene name
SNRPD1, HsT2456, SMD1, SNRPD, Sm-D1
Definition
(RefSeq) small nuclear ribonucleoprotein D1 polypeptide
  KO
K11087  small nuclear ribonucleoprotein D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05322  Systemic lupus erythematosus
Module
hsa_M00351  Spliceosome, U1-snRNP
hsa_M00352  Spliceosome, U2-snRNP
hsa_M00354  Spliceosome, U4/U6.U5 tri-snRNP
hsa_M00355  Spliceosome, 35S U5-snRNP
hsa_M00398  Sm core complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6632 (SNRPD1)
 09160 Human Diseases
  09163 Immune diseases
   05322 Systemic lupus erythematosus
    6632 (SNRPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6632 (SNRPD1)
   03032 DNA replication proteins [BR:hsa03032]
    6632 (SNRPD1)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6632 (SNRPD1)
  U2 snRNP components
    6632 (SNRPD1)
 Complex B
  U1 snRNP components
    6632 (SNRPD1)
  U4/U6.U5 tri-snRNP components
    6632 (SNRPD1)
 Complex C
  U2 snRNP components
    6632 (SNRPD1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6632 (SNRPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM Hfq Gemin7 SM-ATX
Motif
Other DBs
NCBI-GeneID: 6632
NCBI-ProteinID: NP_008869
OMIM: 601063
HGNC: 11158
Ensembl: ENSG00000167088
Vega: OTTHUMG00000178934
Pharos: P62314(Tbio)
UniProt: P62314
Structure
PDB: 

Position
18q11.2
AA seq 119 aa AA seqDB search
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgtgagatttttgatgaaattgagtcatgaaactgtaaccattgaattgaag
aacggaacacaggtccatggaacaatcacaggtgtggatgtcagcatgaatacacatctt
aaagctgtgaaaatgaccctgaagaacagagaacctgtacagctggaaacgctgagtatt
cgaggaaataacattcggtattttattctaccagacagtttacctctggatacactactt
gtggatgttgaacctaaggtgaaatctaagaaaagggaagctgttgcaggaagaggcaga
ggaagaggaagaggaagaggacgtggccgtggcagaggaagagggggtcctaggcgataa

DBGET integrated database retrieval system