KEGG   Homo sapiens (human): 6637Help
Entry
6637              CDS       T01001                                 

Gene name
SNRPG, SMG, Sm-G
Definition
(RefSeq) small nuclear ribonucleoprotein polypeptide G
  KO
K11099  small nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6637 (SNRPG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6637 (SNRPG)
   03032 DNA replication proteins [BR:hsa03032]
    6637 (SNRPG)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6637 (SNRPG)
  U2 snRNP components
    6637 (SNRPG)
 Complex B
  U1 snRNP components
    6637 (SNRPG)
  U4/U6.U5 tri-snRNP components
    6637 (SNRPG)
 Complex C
  U2 snRNP components
    6637 (SNRPG)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6637 (SNRPG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LSM
Motif
Other DBs
NCBI-GeneID: 6637
NCBI-ProteinID: NP_003087
OMIM: 603542
HGNC: 11163
Ensembl: ENSG00000143977
Vega: OTTHUMG00000129670
Pharos: P62308(Tdark)
UniProt: P62308
Structure
PDB: 

Position
2p13.3
AA seq 76 aa AA seqDB search
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagctcaccctcccgagttgaaaaaatttatggacaagaagttatcattgaaa
ttaaatggtggcagacatgtccaaggaatattgcggggatttgatccctttatgaacctt
gtgatagatgaatgtgtggagatggcgactagtggacaacagaacaatattggaatggtg
gtaatacgaggaaatagtatcatcatgttagaagccttggaacgagtataa

DBGET integrated database retrieval system