KEGG   Homo sapiens (human): 6646Help
Entry
6646              CDS       T01001                                 

Gene name
SOAT1, ACACT, ACAT, ACAT-1, ACAT1, SOAT, STAT
Definition
(RefSeq) sterol O-acyltransferase 1
  KO
K00637  sterol O-acyltransferase [EC:2.3.1.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00100  Steroid biosynthesis
hsa04979  Cholesterol metabolism
Drug target
Avasimibe: D03012
Cetaben sodium: D03447
Eldacimibe: D03734
Lecimibide: D03735
Melinamide: D01202
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    6646 (SOAT1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    6646 (SOAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.26  sterol O-acyltransferase
     6646 (SOAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT COX6C
Motif
Other DBs
NCBI-GeneID: 6646
NCBI-ProteinID: NP_003092
OMIM: 102642
HGNC: 11177
Ensembl: ENSG00000057252
Vega: OTTHUMG00000035253
Pharos: P35610(Tchem)
UniProt: P35610
Position
1q25.2
AA seq 550 aa AA seqDB search
MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEE
LKPFFMKEVGSHFDDFVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGK
IFIARRSLLDELLEVDHIRTIYHMFIALLILFILSTLVVDYIDEGRLVLEFSLLSYAFGK
FPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGFLFMIFQIGVLGFGPT
YVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSAR
VLVLCVFNSILPGVLILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTW
NVVVHDWLYYYAYKDFLWFFSKRFKSAAMLAVFAVSAVVHEYALAVCLSFFYPVLFVLFM
FFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYARQHCPLKNPTFLDYVR
PRSWTCRYVF
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggtgggtgaagagaagatgtctctaagaaaccggctgtcaaagtccagggaaaatcct
gaggaagatgaagaccagagaaaccctgcaaaggagtccctagagacacctagtaatggt
cgaattgacataaaacagttgatagcaaagaagataaagttgacagcagaggcagaggaa
ttgaagccattttttatgaaggaagttggcagtcactttgatgattttgtgaccaatctc
attgaaaagtcagcatcattagataatggtgggtgcgctctcacaaccttttctgttctt
gaaggagagaaaaacaaccatagagcgaaggatttgagagcacctccagaacaaggaaag
atttttattgcaaggcgctctctcttagatgaactgcttgaagtggaccacatcagaaca
atatatcacatgtttattgccctcctcattctctttatcctcagcacacttgtagtagat
tacattgatgaaggaaggctggtgcttgagttcagcctcctgtcttatgcttttggcaaa
tttcctaccgttgtttggacctggtggatcatgttcctgtctacattttcagttccctat
tttctgtttcaacattgggccactggctatagcaagagttctcatccgctgatccgttct
ctcttccatggctttcttttcatgatcttccagattggagttctaggttttggaccaaca
tatgttgtgttagcatatacactgccaccagcttcccggttcatcattatattcgagcag
attcgttttgtaatgaaggcccactcatttgtcagagagaacgtgcctcgggtactaaat
tcagctaaggagaaatcaagcactgttccaatacctacagtcaaccagtatttgtacttc
ttatttgctcctacccttatctaccgtgacagctatcccaggaatcccactgtaagatgg
ggttatgtcgctatgaagtttgcacaggtctttggttgctttttctatgtgtactacatc
tttgaaaggctttgtgcccccttgtttcggaatatcaaacaggagcccttcagcgctcgt
gttctggtcctatgtgtatttaactccatcttgccaggtgtgctgattctcttccttact
ttttttgcctttttgcactgctggctcaatgcctttgctgagatgttacgctttggtgac
aggatgttctataaggattggtggaactccacgtcatactccaactattatagaacctgg
aatgtggtggtccatgactggctatattactatgcttacaaggactttctctggtttttc
tccaagagattcaaatctgctgccatgttagctgtctttgctgtatctgctgtagtacac
gaatatgccttggctgtttgcttgagctttttctatcccgtgctcttcgtgctcttcatg
ttctttggaatggctttcaacttcattgtcaatgatagtcggaaaaagccgatttggaat
gttctgatgtggacttctcttttcttgggcaatggagtcttactctgcttttattctcaa
gaatggtatgcacgtcagcactgtcctctgaaaaatcccacatttttggattatgtccgg
ccacgttcctggacttgtcgttacgtgttttag

DBGET integrated database retrieval system